% % This file is formatted by: % bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on % % If the reference uses PETSc, include a field listing components used, e.g. % petsc_uses = {KSP, SNES, TS, TAO}, % % For journal names, write out the full name, do not define abbreviations % % There are some additional historical comments below which may be of interest, % particularly in terms of notes about particularly impactful publications using PETSc. % % LiteralHTML: % LiteralHTML:

Research and Publications that make use of PETSc

% LiteralHTML: % LiteralHTML:

Nano-simulations

% LiteralHTML: @Misc{ semver-webpage, author = {{Semantic Versioning 2.0.0}}, note = {\url{https://semver.org}} } @article{veldhuizen1984d, title = {{D}-stability and {K}aps-{R}entrop-methods}, author = {Veldhuizen, M van}, journal = {Computing}, volume = {32}, number = {3}, pages = {229--237}, year = {1984}, publisher = {Springer} } @article{shampine1982implementation, title = {Implementation of {R}osenbrock methods}, author = {Shampine, Lawrence F}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {8}, number = {2}, pages = {93--113}, year = {1982}, publisher = {ACM New York, NY, USA} } @book{wanner1996solving, title = {Solving ordinary differential equations {II}}, author = {Wanner, Gerhard and Hairer, Ernst}, volume = {375}, year = {1996}, publisher = {Springer Berlin Heidelberg New York} } @article{kaps1979generalized, title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, author = {Kaps, Peter and Rentrop, Peter}, journal = {Numerische Mathematik}, volume = {33}, pages = {55--68}, year = {1979}, publisher = {Springer} } @book{butcher2016numerical, title = {Numerical methods for ordinary differential equations}, author = {Butcher, John Charles}, year = {2016}, publisher = {John Wiley \& Sons} } @article{chung1993, author = {Chung, J. and Hulbert, G. M.}, title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, journal = {Journal of Applied Mechanics}, volume = {60}, number = {2}, pages = {371-375}, year = {1993}, month = {06}, issn = {0021-8936}, doi = {10.1115/1.2900803}, url = {https://doi.org/10.1115/1.2900803}, eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, } @article{hosea1996analysis, title = {Analysis and implementation of {TR-BDF2}}, author = {Hosea, ME and Shampine, LF}, journal = {Applied Numerical Mathematics}, volume = {20}, number = {1-2}, pages = {21--37}, year = {1996}, publisher = {Elsevier} } @article{kennedy2019diagonally, title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, author = {Kennedy, Christopher A and Carpenter, Mark H}, journal = {Applied Numerical Mathematics}, volume = {146}, pages = {221--244}, year = {2019}, publisher = {Elsevier} } @inproceedings{xu2017adaptive, title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, pages = {7389--7398}, year = {2017} } @article{hindmarsh1996time, title = {Time-step limits for stable solutions of the ice-sheet equation}, author = {Hindmarsh, Richard CA and Payne, Antony J}, journal = {Annals of Glaciology}, volume = {23}, pages = {74--85}, year = {1996}, publisher = {Cambridge University Press} } @article{benson2006flexible, title = {Flexible complementarity solvers for large-scale applications}, author = {Benson, Steven J and Munson, Todd S}, journal = {Optimization Methods and Software}, volume = {21}, number = {1}, pages = {155--168}, year = {2006}, publisher ={Taylor \& Francis} } @article{byrd1994representations, title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, journal = {Mathematical Programming}, volume = {63}, number = {1-3}, pages = {129--156}, year = {1994}, publisher = {Springer} } @article{gilbert1989some, title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, journal = {Mathematical programming}, volume = {45}, number = {1-3}, pages = {407--435}, year = {1989}, publisher = {Springer} } @inproceedings{dener2019accelerating, title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, author = {Dener, Alp and Munson, Todd}, booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, pages = {495--507}, year = {2019}, organization = {Springer} } @article{park2021linear, title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, journal = {Advances in Water Resources}, volume = {156}, pages = {104029}, year = {2021}, publisher = {Elsevier} } @inproceedings{va1981design, title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, booktitle = {9th Computational Fluid Dynamics Conference}, pages = {1933}, year = {1981} } @article{pierce1997preconditioned, title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, author = {Pierce, Niles A and Giles, Michael B}, journal = {Journal of Computational Physics}, volume = {136}, number = {2}, pages = {425--445}, year = {1997}, publisher = {Elsevier} } @article{kong2016highly, title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, author = {Kong, Fande and Cai, Xiao-Chuan}, journal = {SIAM Journal on Scientific Computing}, volume = {38}, number = {2}, pages = {C73--C95}, year = {2016}, publisher = {SIAM} } @inproceedings{gutierrez2017accommodating, title = {Accommodating thread-level heterogeneity in coupled parallel applications}, author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, pages = {469--478}, year = {2017}, organization = {IEEE} } @article{heroux2011bi, title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, journal = {IJHPCA (Submitted)}, year = {2011} } @inproceedings{bozdaug2005parallel, title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, booktitle = {International conference on high performance computing and communications}, pages = {796--806}, year = {2005}, organization = {Springer} } @article{dohrmann2009overlapping, title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, author = {Dohrmann, Clark R and Widlund, Olof B}, journal = {SIAM journal on numerical analysis}, volume = {47}, number = {4}, pages = {2897--2923}, year = {2009}, publisher = {SIAM} } @article{dohrmann2008domain, title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, journal = {SIAM journal on numerical analysis}, volume = {46}, number = {4}, pages = {2153--2168}, year = {2008}, publisher = {SIAM} } @incollection{dohrmann2008family, title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, booktitle = {Domain decomposition methods in science and engineering XVII}, pages = {247--254}, year = {2008}, publisher = {Springer} } @book{dohrmann2008extending, title = {Extending theory for domain decomposition algorithms to irregular subdomains}, author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, year = {2008}, publisher = {Springer} } @article{dryja1994schwarz, title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, journal = {SIAM journal on numerical analysis}, volume = {31}, number = {6}, pages = {1662--1694}, year = {1994}, publisher = {SIAM} } @book{smith1990domain, title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, author = {Smith, Barry F}, year = {1990}, publisher = {New York University} } @article{bramble1989construction, title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, journal = {Mathematics of Computation}, volume = {53}, number = {187}, pages = {1--24}, year = {1989} } @article{kaczmarz1937angenaherte, title = {Angenaherte auflosung von systemen linearer gleichungen}, author = {Kaczmarz, Stefan}, journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, pages = {355--357}, year = {1937} } @article{nataf2022recent, title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, journal = {Comptes Rendus. M{\'e}canique}, volume = {350}, number = {S1}, pages = {1--15}, year = {2022} } @article{al2022robustpd, title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, author = {Al Daas, Hussam and Jolivet, Pierre}, journal = {SIAM Journal on Scientific Computing}, volume = {44}, number = {4}, pages = {A2582--A2598}, year = {2022}, publisher = {SIAM} } @article{al2022robust, title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, journal = {SIAM Journal on Scientific Computing}, volume = {44}, number = {3}, pages = {A1047--A1068}, year = {2022}, publisher = {SIAM} } @article{al2021multilevel, title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, journal = {SIAM Journal on Scientific Computing}, volume = {43}, number = {3}, pages = {A1907--A1928}, year = {2021}, publisher = {SIAM} } @book{dolean2015introduction, title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, year = {2015}, publisher = {SIAM} } @article{spillane2011robust, title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, journal = {Comptes Rendus Mathematique}, volume = {349}, number = {23-24}, pages = {1255--1259}, year = {2011}, publisher = {Elsevier} } @article{kong2020highly, title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, Alexander D and DeHart, Mark D and Martineau, Richard C}, journal = {SIAM Journal on Scientific Computing}, volume = {42}, number = {5}, pages = {C193--C220}, year = {2020}, publisher = {SIAM} } @article{ipsen2001note, title = {A note on preconditioning nonsymmetric matrices}, author = {Ipsen, Ilse CF}, journal = {SIAM Journal on Scientific Computing}, volume = {23}, number = {3}, pages = {1050--1051}, year = {2001}, publisher = {SIAM} } @article{murphy2000note, title = {A note on preconditioning for indefinite linear systems}, author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, journal = {SIAM Journal on Scientific Computing}, volume = {21}, number = {6}, pages = {1969--1972}, year = {2000}, publisher = {SIAM} } @article{oliphant1961implicit, title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, author = {Oliphant, Thomas A}, journal = {Quarterly of Applied mathematics}, volume = {19}, number = {3}, pages = {221--229}, year = {1961} } @article{dupont1968approximate, title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, journal = {SIAM Journal on Numerical Analysis}, volume = {5}, number = {3}, pages = {559--573}, year = {1968}, publisher = {SIAM} } @inproceedings{manteuffel1979shifted, title = {Shifted incomplete {C}holesky factorization}, author = {Manteuffel, Thomas A}, booktitle = {Sparse Matrix Proceedings 1978}, pages = {41--61}, year = {1979}, organization = {SIAM, Philadelphia, PA} } @incollection{chan1997approximate, title = {Approximate and incomplete factorizations}, author = {Chan, Tony F and Van Der Vorst, Henk A}, booktitle = {Parallel numerical algorithms}, pages = {167--202}, year = {1997}, publisher = {Springer} } @article{mandel2008multispace, title = {Multispace and multilevel {BDDC}}, author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, journal = {Computing}, volume = {83}, number = {2-3}, pages = {55--85}, year = {2008}, publisher = {Springer} } @article{klawonn2006dual, title = {Dual-primal {FETI} methods for linear elasticity}, author = {Klawonn, Axel and Widlund, Olof B}, journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, volume = {59}, number = {11}, pages = {1523--1572}, year = {2006}, publisher = {Wiley Online Library} } @article{dohrmann2007approximate, title = {An approximate {BDDC} preconditioner}, author = {Dohrmann, Clark R}, journal = {Numerical Linear Algebra with Applications}, volume = {14}, number = {2}, pages = {149--168}, year = {2007}, publisher = {Wiley Online Library} } @book{dryja1987additive, title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, author = {Dryja, Maksymilian and Widlund, Olof}, year = {1987}, publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} } @article{couturier2016tsirm, title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, journal = {Journal of Computational Science}, volume = {17}, pages = {535--546}, year = {2016}, publisher = {Elsevier} } @article{chan1998transpose, title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, journal = {Numerical Algorithms}, volume = {17}, pages = {51--66}, year = {1998}, publisher = {Springer} } @article{catabriga2006performance, title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, journal = {Communications in numerical methods in engineering}, volume = {22}, number = {6}, pages = {643--656}, year = {2006}, publisher = {Wiley Online Library} } @article{catabriga2004evaluating, title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, journal = {International Journal for Numerical Methods in Engineering}, volume = {60}, number = {9}, pages = {1513--1534}, year = {2004}, publisher = {Wiley Online Library} } @article{dai2004study, title = {Study on semi-conjugate direction methods for non-symmetric systems}, author = {Dai, Yu-Hong and Yuan, Jinyun}, journal = {International journal for numerical methods in engineering}, volume = {60}, number = {8}, pages = {1383--1399}, year = {2004}, publisher = {Wiley Online Library} } @article{yuan2004semi, title = {Semi-conjugate direction methods for real positive definite systems}, author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, journal = {BIT Numerical Mathematics}, volume = {44}, pages = {189--207}, year = {2004}, publisher = {Springer} } @article{ji2017breakdown, title = {A breakdown-free block conjugate gradient method}, author = {Ji, Hao and Li, Yaohang}, journal = {BIT Numerical Mathematics}, volume = {57}, pages = {379--403}, year = {2017}, publisher = {Springer} } @inproceedings{jolivet2016block, title = {Block iterative methods and recycling for improved scalability of linear solvers}, author = {Jolivet, Pierre and Tournier, Pierre-Henri}, booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {190--203}, year = {2016}, organization = {IEEE} } @article{calandra2013modified, title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, journal = {SIAM Journal on Scientific Computing}, volume = {35}, number = {5}, pages = {S345--S367}, year = {2013}, publisher = {SIAM} } @article{o1980block, title = {The block conjugate gradient algorithm and related methods}, author = {O'Leary, Dianne P}, journal = {Linear algebra and its applications}, volume = {29}, pages = {293--322}, year = {1980}, publisher = {Elsevier} } @article{erhel1996restarted, title = {Restarted {GMRES} preconditioned by deflation}, author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, journal = {Journal of computational and applied mathematics}, volume = {69}, number = {2}, pages = {303--318}, year = {1996}, publisher = {Elsevier} } @article{bai1994newton, title = {A {N}ewton basis {GMRES} implementation}, author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, journal = {IMA Journal of Numerical Analysis}, volume = {14}, number = {4}, pages = {563--581}, year = {1994}, publisher = {Oxford University Press} } @article{sidje1997alternatives, title = {Alternatives for parallel Krylov subspace basis computation}, author = {Sidje, Roger B}, journal = {Numerical linear algebra with applications}, volume = {4}, number = {4}, pages = {305--331}, year = {1997}, publisher = {Wiley Online Library} } @inproceedings{mohiyuddin2009minimizing, title = {Minimizing communication in sparse matrix solvers}, author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, pages = {1--12}, year = {2009} } @article{demmel2012communication, title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, journal = {SIAM Journal on Scientific Computing}, volume = {34}, number = {1}, pages = {A206--A239}, year = {2012}, publisher = {SIAM} } @article{philippe2012generation, title = {On the generation of {K}rylov subspace bases}, author = {Philippe, Bernard and Reichel, Lothar}, journal = {Applied Numerical Mathematics}, volume = {62}, number = {9}, pages = {1171--1186}, year = {2012}, publisher = {Elsevier} } @article{wakam2013memory, title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, journal = {Computers \& Fluids}, volume = {80}, pages = {158--167}, year = {2013}, publisher = {Elsevier} } @misc{wakam2011parallelism, title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, year = {2011}, url = {https://hal.inria.fr/inria-00638247/en} } @article{tu2015feti, title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, author = {Tu, Xuemin and Li, Jing}, journal = {SIAM Journal on Numerical Analysis}, volume = {53}, number = {2}, pages = {720--742}, year = {2015}, publisher = {SIAM} } @article{farhat2001feti, title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, journal = {International journal for numerical methods in engineering}, volume = {50}, number = {7}, pages = {1523--1544}, year = {2001}, publisher = {Wiley Online Library} } @article{lottes2023optimal, title = {Optimal polynomial smoothers for multigrid {V}-cycles}, author = {Lottes, James}, journal = {Numerical Linear Algebra with Applications}, volume = {30}, number = {6}, pages = {e2518}, year = {2023}, publisher = {Wiley Online Library} } @article{phillips2022optimal, title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, author = {Phillips, Malachi and Fischer, Paul}, journal = {arXiv preprint arXiv:2210.03179}, year = {2022} } @incollection{toint1981towards, title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, author = {Toint, Philippe}, booktitle = {Sparse matrices and their uses}, pages = {57--88}, year = {1981}, publisher = {Academic press} } @article{cools2019numerically, title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, journal = {IEEE Transactions on Parallel and Distributed Systems}, volume = {30}, number = {11}, pages = {2507--2522}, year = {2019}, publisher = {IEEE} } @article{cornelis2018communication, title = {The communication-hiding conjugate gradient method with deep pipelines}, author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, journal = {arXiv preprint arXiv:1801.04728}, year = {2018} } @article{d1993conjugate, title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, year = {1993} } @book{malek2014preconditioning, title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, year = {2014}, publisher = {SIAM} } @book{fokkema1996enhanced, title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, author = {Fokkema, Diederik R}, year = {1996}, publisher = {Citeseer} } @article{sleijpen1994bicgstab, title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, journal = {Numerical Algorithms}, volume = {7}, pages = {75--109}, year = {1994}, publisher = {Springer} } @article{sleijpen1995overview, title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, journal = {Applied numerical mathematics}, volume = {19}, number = {3}, pages = {235--254}, year = {1995}, publisher = {Elsevier} } @article{fischer1998projection, title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, author = {Fischer, Paul F}, journal = {Computer methods in applied mechanics and engineering}, volume = {163}, number = {1-4}, pages = {193--204}, year = {1998}, publisher = {Elsevier} } @article{maskery2018insights, title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures made by polymer additive manufacturing}, author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, journal = {Polymer}, volume = {152}, pages = {62--71}, year = {2018}, publisher = {Elsevier} } @book{karniadakis2005spectral, title = {Spectral/hp element methods for computational fluid dynamics}, author = {Karniadakis, George and Sherwin, Spencer J}, year = {2005}, publisher = {Oxford University Press, USA} } @article{golub1969calculation, title = {Calculation of {G}auss quadrature rules}, author = {Golub, Gene H and Welsch, John H}, journal = {Mathematics of computation}, volume = {23}, number = {106}, pages = {221--230}, year = {1969} } @article{soderlind2006adaptive, title = {Adaptive time-stepping and computational stability}, author = {S{\"o}derlind, Gustaf and Wang, Lina}, journal = {Journal of Computational and Applied Mathematics}, volume = {185}, number = {2}, pages = {225--243}, year = {2006}, publisher = {Elsevier} } @article{soderlind2003digital, title = {Digital filters in adaptive time-stepping}, author = {S{\"o}derlind, Gustaf}, journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, volume = {29}, number = {1}, pages = {1--26}, year = {2003}, publisher = {ACM New York, NY, USA} } @article{volkwein2013proper, title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, author = {Volkwein, Stefan}, journal = {Lecture Notes, University of Konstanz}, volume = {4}, number = {4}, pages = {1--29}, year = {2013}, url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} } @article{frisvad2012building, title = {Building an orthonormal basis from a {3D} unit vector without normalization}, author = {Frisvad, Jeppe Revall}, journal = {Journal of Graphics Tools}, volume = {16}, number = {3}, pages = {151--159}, year = {2012}, publisher = {Taylor \& Francis} } @article{constantinescu2007multirate, title = {Multirate timestepping methods for hyperbolic conservation laws}, author = {Constantinescu, Emil M and Sandu, Adrian}, journal = {Journal of Scientific Computing}, volume = {33}, number = {3}, pages = {239--278}, year = {2007}, publisher = {Springer} } @article{liu2022newton, title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, author = {Liu, Yang and Roosta, Fred}, journal = {arXiv preprint arXiv:2208.07095}, year = {2022} } @article{choi2011minres, title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {4}, pages = {1810--1836}, year = {2011}, publisher = {SIAM} } @article{chen2020predict, title = {Predict-and-recompute conjugate gradient variants}, author = {Chen, Tyler and Carson, Erin}, journal = {SIAM Journal on Scientific Computing}, volume = {42}, number = {5}, pages = {A3084--A3108}, year = {2020}, publisher = {SIAM} } @article{cools2018analyzing, title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {39}, number = {1}, pages = {426--450}, year = {2018}, publisher = {SIAM} } @inproceedings{tiwari2020pipelined, title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, author = {Tiwari, Manasi and Vadhiyar, Sathish}, booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, pages = {151--160}, year = {2020}, organization = {IEEE} } @article{nash1984newton, title = {Newton-type minimization via the {L}anczos method}, author = {Nash, Stephen G}, journal = {SIAM Journal on Numerical Analysis}, volume = {21}, number = {4}, pages = {770--788}, year = {1984}, publisher = {SIAM} } @inproceedings{eller2016scalable, title = {Scalable non-blocking preconditioned conjugate gradient methods}, author = {Eller, Paul R and Gropp, William}, booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {204--215}, year = {2016}, organization = {IEEE} } @article{gould1999solving, title = {Solving the trust-region subproblem using the Lanczos method}, author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, journal = {SIAM Journal on Optimization}, volume = {9}, number = {2}, pages = {504--525}, year = {1999}, publisher = {SIAM} } @article{cools2017communication, title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, author = {Cools, Siegfried and Vanroose, Wim}, journal = {Parallel Computing}, volume = {65}, pages = {1--20}, year = {2017}, publisher = {Elsevier} } @Misc{moabwebsite, key = {MOAB}, title = {{MOAB} Website}, howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, year = {2023} } @book{deuflhard2011, title = {{N}ewton Methods for Nonlinear Problems}, author = {Peter Deuflhard}, volume = {35}, year = {2011}, isbn = {978-3-642-23898-7}, doi = {10.1007/978-3-642-23899-4}, publisher = {Springer-Verlag}, address = {Berlin, Heidelberg} } @article{ketcheson2010runge, title = {{R}unge--{K}utta methods with minimum storage implementations}, author = {Ketcheson, David I}, journal = {Journal of Computational Physics}, volume = {229}, number = {5}, pages = {1763--1773}, year = {2010}, publisher = {Elsevier} } @article{WalkerNi2011, title = {{A}nderson acceleration for fixed-point iterations}, author = {Homer F Walker and Peng Ni}, journal = {SIAM Journal on Numerical Analysis}, volume = {49}, number = {4}, pages = {1715--1735}, year = {2011}, publisher = {SIAM} } @article{Hua2007, title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, journal = {AIChE Journal}, volume = {53}, number = {10}, pages = {2534--2548}, year = {2007}, publisher = {Wiley Online Library} } @Article{ openblas, title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, journal = {Journal of Software}, volume = {22}, pages = {208--216}, year = {2011}, url = {https://www.jos.org.cn/josen/article/abstract/11042}, author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} } @Misc{ openblas-website, title = {{OpenBLAS}}, key = {OpenBLAS}, howpublished = {\url{https://www.openblas.net}} } @Misc{ openacc-website, title = {{OpenACC}}, key = {OpenACC}, howpublished = {\url{https://www.openacc.org}} } @Misc{ bueler2020petsc, title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, author = {Bueler, Ed}, year = {2020}, publisher = {SIAM}, petsc_uses = {KSP} } @TechReport{ petscforgpuexascale, title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, institution = {Argonne National Laboratory}, number = {ANL/MCS-P9401-1020}, note = {\url{https://arxiv.org/abs/2011.00715}}, year = {2020}, petsc_uses = {KSP} } @Article{ mills2021, title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, journal = {Parallel Computing}, volume = {108}, pages = {102831}, year = {2021}, issn = {0167-8191}, doi = {https://doi.org/10.1016/j.parco.2021.102831}, url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} } @Article{ mills2024, title = {{PETSc/TAO} Developments for Early Exascale Systems}, author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Jacob Faibussowitsch and Tobin Isaac and Matthew G. Knepley and Todd Munson and Hansul Suh and Stefano Zampini and Hong Zhang and Junchao Zhang}, journal = {International Journal of High Performance Computing Applications}, url = {http://arxiv.org/abs/2401.05868}, doi = {https://doi.org/10.1177/10943420241303710}, year = {2024} } @Article{ rupp:2016:pis:2988256.2907944, author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, journal = {ACM Trans. Math. Softw.}, issue_date = {September 2016}, volume = {43}, number = {2}, month = aug, year = {2016}, issn = {0098-3500}, pages = {11:1--11:27}, articleno = {11}, numpages = {27}, doi = {10.1145/2907944}, acmid = {2907944}, publisher = {ACM}, address = {New York, NY, USA}, keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate gradient method}, petsc_uses = {KSP} } @Article{ dalcin2011parallel, title = {Parallel distributed computing using python}, author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, journal = {Advances in Water Resources}, volume = {34}, number = {9}, pages = {1124--1139}, year = {2011}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ mendezpongaortiz2018, title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, author = {JP Mendez and M Ponga and M Ortiz}, journal = {Journal of the Mechanics and Physics of Solids}, year = {2018}, petsc_uses = {KSP} } @TechReport{ morgan2020evaluation, title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit System: Part 1: Vector Node Performance}, author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, year = {2020}, institution = {Argonne National Laboratory}, url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, petsc_uses = {KSP} } @TechReport{ pdeconstrainedspectraladjoints, title = {PDE constrained optimization, error estimation and control with spectral elements using PETSc and TAO}, author = {Oana Marin and Emil Constantinescu and Barry Smith}, type = {Preprint}, number = {ANL/MCS-P9031-1117}, institution = {ANL}, month = nov, year = {2017}, petsc_uses = {KSP} } @InProceedings{ asc2013, author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for parallel solution of very large power flow problems}, booktitle = {HiPCNA-PG’13}, year = {2013}, petsc_uses = {KSP} } @InProceedings{ as2013, author = {S. Abhyankar and B. F. Smith}, title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel Smart Grid Applications}, booktitle = {Proceedings of the IEEE PES General Meeting}, year = {2013}, petsc_uses = {KSP} } @TechReport{ tspaper, title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and Barry F. Smith}, type = {Preprint}, number = {ANL/MCS-P5061-0114}, institution = {ANL}, month = jan, year = {2014}, petsc_uses = {KSP} } @TechReport{ abhyankaretal2018, author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh and Barry F. Smith and Hong Zhang}, title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, journal = {arXiv e-preprints}, eprint = {1806.01437}, archiveprefix = {arXiv}, year = {2018}, petsc_uses = {KSP} } @Article{ zhang2021cams, title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, author = {Hong Zhang and Emil M. Constantinescu}, journal = {arXiv e-preprints}, eprint = {2202.11890}, archiveprefix = {arXiv}, year = {2022}, petsc_uses = {KSP} } @InProceedings{ zhangconstantinescu2021b, title = {Revolve-based adjoint checkpointing for multistage time integration}, author = {Hong Zhang and Emil M. Constantinescu}, booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, month = jun, year = {2021}, petsc_uses = {KSP} } @Article{ zhang2022tsadjoint, author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order Sensitivity Analysis}}, journal = {SIAM Journal on Scientific Computing}, volume = {44}, number = {1}, pages = {C1-C24}, year = {2022}, doi = {10.1137/21M140078X}, petsc_uses = {KSP} } @TechReport{ bb2008, author = {Tomasz Blachowicz and Bartlomiej Baron}, title = {A graphical extension for the Windows version of the Parallel Finite Element Micromagnetics Package (MagParExt)}, url = {http://arxiv.org/abs/0807.2655}, year = {2008}, petsc_uses = {KSP} } @Article{ jacvgv2008, author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez and J L Vicent}, title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, journal = {Nanotechnology}, volume = {19}, year = {2008}, doi = {10.1088/0957-4484/19/28/285717}, petsc_uses = {KSP} } @Article{ yjdwh2008, author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, journal = {Journal of the Magnetics Society of Japan}, volume = {32}, year = {2008}, pages = {50-53}, url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, petsc_uses = {KSP} } @Article{ mtrtrsa2008, author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. Schrefl and M. Albrecht}, title = {Magnetic strip patterns induced by focused ion beam irradiation}, journal = {J. Appl. Phys.}, volume = {103}, year = {2008}, doi = {10.1063/1.2894587}, petsc_uses = {KSP} } @InProceedings{ tmrttsa2008, author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. Schrefl and M. Albrecht}, title = {Patterning of magnetic films by focused ion beam irradiation}, booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, year = {2008}, petsc_uses = {KSP} } @Article{ yjdbh2007, author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping factor for the single-phase soft magnetic films}, journal = {J. Magn. Magn. Mater.}, volume = {320}, number = {7}, pages = {1393-1397}, doi = {10.1016/j.jmmm.2007.11.025}, petsc_uses = {KSP} } @Article{ lxky2007, author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, title = {Micromagnetic simulation and experimental study on microwave permeability of nano-magnetic films}, journal = {Transactions of Nonferrous Metals Society of China}, year = {2007}, pages = {756-759}, url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, petsc_uses = {KSP} } @Article{ yjdwh2008a, author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, journal = {Journal of the Magnetics Society of Japan}, volume = {32}, year = {2008}, pages = {50-53}, doi = {10.3379/msjmag.32.50}, petsc_uses = {KSP} } @Article{ lylw2007, author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, journal = {Phys. Stat. Sol.}, volume = {204}, number = {12}, pages = {4049-4052}, year = {2007}, doi = {10.1002/pssa.200777359}, petsc_uses = {KSP} } @InProceedings{ sg2007, author = {Simon Greaves}, title = {Micromagnetic Simulations of Magnetic Recording Media}, booktitle = {High Performance Computing on Vector Systems 2007}, doi = {10.1007/978-3-540-74384-2_17}, petsc_uses = {KSP} } @Article{ bsc2007, author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, journal = {IEEE Trans. Magn.}, volume = {43}, year = {2007}, pages = {2884-2886}, doi = {10.1109/TMAG.2007.892867}, petsc_uses = {KSP} } @Article{ ffbf, author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based Micromagnetic Simulations: Nmag.}, journal = {IEEE Trans. Magn. Volume}, volume = {43}, pages = {2896-2898}, doi = {10.1109/TMAG.2007.893843}, petsc_uses = {KSP} } @InBook{ dfssfs2006, author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, chapter = {Computational Aspects of Micromagnetics}, title = {The Science of Hysteresis}, editor = { G. Bertotti and I. Mayergoyz}, url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, petsc_uses = {KSP} } @InBook{ fss, author = {J. Fidler and T. Schrefl and W. Scholz}, chapter = {Computational Micromagnetics}, title = {Handbook of Theoretical and Computational Nanotechnology}, editor = {M. Rieth and W. Schommers}, url = {http://www.amazon.com/gp/product/158883042X}, petsc_uses = {KSP} } @InBook{ shbsef, author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and Josef Fidler}, chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, title = {Handbook of Magnetism and Advanced Magnetic Materials}, editor = {Helmut Kronmueller and Stuart Parkin}, doi = {10.1002/9780470022184.hmm203}, petsc_uses = {KSP} } @InBook{ sfs, author = {D. Suess and J. Fidler and T. Schrefl}, chapter = {Micromagnetic Simulation of magnetic materials}, title = {Handbook of Magnetic Materials}, editor = {K. H. J. Buschow}, url = {http://www.amazon.com/gp/product/0444518509}, petsc_uses = {KSP} } @Article{ fsxzs, author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. Sharma}, title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular Recording.}, journal = {IEEE Trans. Magn. Volume}, volume = {43}, pages = {2175-2177}, doi = {10.1109/TMAG.2007.893122}, petsc_uses = {KSP} } @Article{ sb2006, author = {W. Scholz and S. Batra}, title = {Effect of write current waveform on magnetization and head field dynamics of perpendicular recording heads}, journal = {IEEE Trans. Magn.}, volume = {42}, year = {2006}, pages = {2264--2266}, url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, petsc_uses = {KSP} } @Article{ bsr2006, author = {S. Batra and W. Scholz and T. Roscamp}, title = {Effect of thermal fluctuation field on the noise performance of a perpendicular recording system}, journal = {J. Appl. Phys.}, volume = {99}, year = {2006}, url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, petsc_uses = {KSP} } @InProceedings{ japios2006, author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. Subramanian}, title = {Micromagnetic simulations of the dependence of domain wall width with grain size in systems with cubic and uniaxial anisotropy.}, booktitle = {Intermag 2006 Conference}, petsc_uses = {KSP} } @Article{ kbmb2006, author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in Perpendicular Recording Heads}, journal = {IEEE Trans. Magn.}, volume = {42}, year = {2006}, pages = {2428--2430}, doi = {10.1109/TMAG.2006.879430}, petsc_uses = {KSP} } @Article{ cclcw2006, author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, title = {Control of Domain Wall Motion in Permalloy Ring}, journal = {IEEE Trans. Magn.}, volume = {42}, year = {2006}, pages = {2960--2962}, doi = {10.1109/TMAG.2006.878414}, petsc_uses = {KSP} } @Article{ bfmfzczg2007, author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, title = {Micromagnetic modelling of ferromagnetic cones}, journal = {J. Magn. Magn. Mater.}, volume = {312}, year = {2007}, pages = {234-238}, url = {http://eprints.soton.ac.uk/45900/}, petsc_uses = {KSP} } @PhDThesis{ rb2005, author = {Richard Boardman}, title = {Computer simulation studies of magnetic nanostructures}, school = {Computational Engineering and Design Group, School of Engineering Sciences, University of Southampton, United Kingdom}, year = {2005}, url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, petsc_uses = {KSP} } @InProceedings{ cwwy2006, author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, title = {MPI Performance Analysis Tools on Blue Gene/L}, booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, year = {2006}, url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, petsc_uses = {KSP} } @InProceedings{ ch2006, author = {I.-H. Chung and J.K. Hollingsworth}, title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific Programs}, booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, pages = {45--56}, doi = {10.1109/HPDC.2006.1652135}, petsc_uses = {KSP} } @Article{ lkpl2005, author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, title = {Multibit {MRAM} using a pair of memory cells}, journal = {IEEE Trans. Magn.}, volume = {41}, year = {2005}, pages = {2670-2672}, doi = {10.1109/TMAG.2005.855288}, petsc_uses = {KSP} } @Article{ gscn2005, author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, title = {Vortex state oscillations in soft magnetic cylindrical dots}, journal = {Phys. Rev. B}, volume = {71}, year = {2005}, doi = {10.1103/PhysRevB.71.144407}, petsc_uses = {KSP} } @PhDThesis{ mda, author = {Massimiliano d'Aquino}, title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, school = { Universita di Napoli Federico II.}, url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, petsc_uses = {KSP} } @TechReport{ ssdfssf2003, author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. Stehno and J. Fidler}, title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, petsc_uses = {KSP} } @InProceedings{ sb2006a, author = {W. Scholz and S. Batra}, title = {Effect of write current waveform on magnetization and head field dynamics of perpendicular recording heads}, booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, petsc_uses = {KSP} } @Article{ scholz-batra1, author = {W. Scholz and S. Batra}, title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular Recording}, journal = {IEEE Trans. Magn.}, note = {submitted}, year = {2005}, petsc_uses = {KSP} } @Article{ scholz-batra2, author = {W. Scholz and S. Batra}, title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, journal = {IEEE Trans. Magn.}, volume = {41}, year = {2005}, pages = {702-706}, petsc_uses = {KSP} } @Article{ daquino-scholz1, author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, title = {Micromagnetic Analysis of Fast Precessional Switching}, journal = {J. Magn. Magn. Mater.}, volume = {290-291}, year = {2005}, pages = {510-513}, petsc_uses = {KSP} } @Article{ aq-scholz-fid, author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, title = {Numerical and analytical study of fast precessional switching}, journal = {J. Appl. Phys.}, volume = {95}, year = {2004}, pages = {7055-7057}, petsc_uses = {KSP} } @InProceedings{ gar-tabik-gar, author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and Scatterers}, booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing (PDP'04)}, year = {2004}, pages = {80--}, petsc_uses = {KSP} } @InProceedings{ aq-scholz-mia, author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, title = {Analysis of fast precessional switching in magnetic thin films}, booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, year = {2004}, pages = {257-260}, petsc_uses = {KSP} } @Article{ scholz-fid-seus, author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. Dittrich and V. Tsiantos}, title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy Axes}, journal = {J. Magn. Magn. Mater.}, year = {2004}, pages = {1524-1525}, petsc_uses = {KSP} } @Article{ boardman-zimmerman, author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and Peter de Groot}, title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, journal = {Journal of Applied Physics}, year = {2005}, petsc_uses = {KSP} } @Article{ lim-kim-park, author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, journal = {IEEE Trans. Magn.}, note = {submitted}, petsc_uses = {KSP} } @Article{ scholz-suess2, author = {W. Scholz and D. Suess and T. Schrefl and J. Fidler}, title = {Micromagnetic simulation of magnetization reversal in small particles with surface anisotropy}, journal = {J. Appl. Phys.}, volume = {95}, year = {2004}, pages = {6807-6809}, petsc_uses = {KSP} } @Article{ scholz-schrefl1, author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. Tsiantos}, title = {Micromagnetic simulation of the pinning and depinning process in permanent magnets}, journal = {IEEE Trans. Magn.}, volume = {39}, year = {2003}, pages = {2920-2922}, petsc_uses = {KSP} } @Article{ scholz-guslienko, author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. W. Chantrell and J. Fidler}, title = {Transition from single-domain to vortex state in soft magnetic cylindrical nanodots}, journal = {J. Magn. Magn. Mater.}, volume = {266}, year = {2003}, pages = {155-163}, petsc_uses = {KSP} } @Article{ scholz1, author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. Forster and V. Tsiantos}, title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, journal = {Comp. Mat. Sci}, year = {2003}, pages = {366--383}, volume = {28}, url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, petsc_uses = {KSP} } @PhDThesis{ scholz2, author = {W. Scholz}, title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, school = {Vienna University of Technology, Vienna, Austria}, year = {2003}, petsc_uses = {KSP} } @Article{ scholz3, author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. Forster and J. Fidler}, title = {Implementation of a high performance parallel finite element micromagnetics package}, journal = {J. Magn. Magn. Mater.}, year = {2004}, url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, petsc_uses = {KSP} } % LiteralHTML:
@InBook{ zhanggladwell1, author = {W. Zhang and I. Gladwell}, chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, year = {2000}, title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in Physics, vol. 552}, publisher = {Springer}, pages = {4190-}, petsc_uses = {KSP} } @Article{ wolf1, author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline thin films}, journal = {Phil. Mag. A}, year = {2003}, lab = {ANL}, petsc_uses = {KSP} } @Article{ wolf2, author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, title = {Mesoscopic simulation of two dimensional grain growth with anisotropic grain-boundary properties}, journal = {Computational Materials Science}, year = {2001}, volume = {23}, pages = {15--32}, lab = {ANL}, petsc_uses = {KSP} } @Article{ wolf3, author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, title = {Role of grain rotation in grain growth by mesoscale simulation}, journal = {Phil. Mag. A}, year = {2002}, volume = {82}, pages = {1271--1297}, lab = {ANL}, petsc_uses = {KSP} } % LiteralHTML:
@Article{ saut, author = { Olivier Saut}, title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, journal = {SIAM Journal on Scientific Computing}, year = {2004}, note = {submitted}, url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Biology -- Medical

% LiteralHTML: @InBook{ khanallorenziayachepennec2016, title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model of Brain Deformation in {Alzheimer's} Disease}, booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol Miller}, pages = {167--176}, isbn = {978-3-319-28329-6}, doi = {10.1007/978-3-319-28329-6_15}, publisher = {Springer International Publishing}, year = {2016}, petsc_uses = {KSP} } @Article{ ataseven, author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human brain}, journal = {Medical and Biological Engineering and Computing}, month = feb, year = {2008}, doi = {10.1007/s11517-008-0316-0}, petsc_uses = {KSP} } @Article{ dennis-eberhart-03, author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, pages = {832-840}, volume = {125}, number = {6}, title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, journal = {J Biomech Eng}, year = {2003}, url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, petsc_uses = {KSP} } @Conference{ gu7174parallel, title = {{A parallel reduced-space sequential-quadratic programming algorithm for frequency-domain small animal optical tomography}}, author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, booktitle = {Proc. of SPIE Vol}, volume = {7174}, number = {717406}, pages = {1}, petsc_uses = {KSP} } @Article{ barchanski2005using, title = {{Using domain decomposition techniques for the calculation of low-frequency electric current densities in high-resolution 3D human anatomy models}}, author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, T.}, journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical and Electronic Engineering}, volume = {24}, number = {2}, pages = {458--467}, issn = {0332-1649}, year = {2005}, publisher = {Emerald Group Publishing Limited}, petsc_uses = {KSP} } @Article{ motrescurienen05, author = {V. C. Motrescu and U. van Rienen}, pages = {227--231}, volume = {3}, title = {Computation of currents induced by {ELF} electric fields in anisotropic human tissues using the Finite Integration Technique}, journal = {Advances in Radio Science}, year = {2005}, url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, petsc_uses = {KSP} } @Article{ motrescurienen04, author = {V. C. Motrescu and U. van Rienen}, pages = {309--313}, volume = {2}, title = {Computation of electrostatic fields in anisotropic human tissues using the Finite Integration Technique (FIT)}, journal = {Advances in Radio Science}, year = {2004}, url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, petsc_uses = {KSP} } @InProceedings{ dbl2, author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, booktitle = {ECCOMAS2000}, year = {2000}, url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, petsc_uses = {KSP} } @Unpublished{ cell, title = {Parallel Simulation Engines for Whole-Cell Models}, author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin Weber}, note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, year = {2001}, petsc_uses = {KSP} } @Article{ barker2010two, title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure interaction}, author = {Barker, A.T. and Cai, X.C.}, journal = {SIAM Journal on Scientific Computing}, volume = {32}, number = {4}, pages = {2395--2417}, year = {2010}, publisher = {Society for Industrial and Applied Mathematics}, petsc_uses = {KSP} } @Article{ barker2010scalable, title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction with application to blood flow modeling}, author = {Barker, A.T. and Cai, X.C.}, journal = {Journal of Computational Physics}, volume = {229}, number = {3}, pages = {642--659}, year = {2010}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ barker2009nks, title = {{NKS} for fully coupled fluid-structure interaction with application}, author = {Barker, A.T. and Cai, X.C.}, journal = {Domain Decomposition Methods in Science and Engineering XVIII}, pages = {275--282}, year = {2009}, publisher = {Springer}, petsc_uses = {KSP} } @Article{ mirams2013, author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan and Yi Cui and Gary R Mirams}, title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data to predict {QT} interval changes in the rabbit ventricular wedge}, journal = {Journal of pharmacological and toxicological methods}, volume = {68}, number = {1}, pages = {88--96}, year = {2013}, doi = {10.1016/j.vascn.2013.04.004}, petsc_uses = {KSP} } % LiteralHTML:
% LiteralHTML:

% LiteralHTML:

% LiteralHTML: % LiteralHTML:Treating fractures of the hip and spine is a major medical cost. % LiteralHTML:Understanding bone mechanical properties and how they may lead to % LiteralHTML:fractures is thus an important medical research activity. PETSc and % LiteralHTML:Prometheus have been used for extremely large scale finite element % LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a % LiteralHTML:team of doctors and computational scientists. This computation was % LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably % LiteralHTML:with over 4000 processors.

% LiteralHTML:
@Article{ arbenz2008scalable, title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element analysis of human bone structures}, author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, journal = {International Journal for Numerical Methods in Engineering}, volume = {73}, number = {7}, pages = {927--947}, year = {2008}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @InProceedings{ adams-04, author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, title = {Ultrascalable implicit finite element analyses in solid mechanics with over a half a billion degrees of freedom}, note = {Gordon Bell Award}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ adams-03b, author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of Whole Bone Micro-Mechanics on the {IBM SP}}, booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ oghattas2002, author = {Volkan Akcelik and George Biros and Omar Ghattas}, title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, booktitle = {Procceedings of SC2002}, url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed by time-dependent PDEs, and scalability results for an inverse wave propagation problem of determining the material field of an acoustic medium. Using the algorithm, they solved a synthetic inverse wave propagation problem though a pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 processors.}, year = {2002}, petsc_uses = {KSP} } % LiteralHTML:
% LiteralHTML:
% LiteralHTML:
% LiteralHTML:

% LiteralHTML: % LiteralHTML: % LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the % LiteralHTML: heart; they are the cause of the majority of sudden cardiac % LiteralHTML: deaths. The heart beat is controlled by electrical signals moving % LiteralHTML: through the heart. PETSc has been used by several research groups to % LiteralHTML: simulate the electronic behavior of the heart in an attempt to more % LiteralHTML: fully understand the developments of arrhthmias.

% LiteralHTML:
@InProceedings{ oghattas2000, author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. Walkington}, title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic Interfaces}, booktitle = {Procceedings of SC2000}, url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, note = {Blood flow modeling at the microscale including effects on individual blood cells, for designing heart assist pumps, etc.}, year = {2000}, petsc_uses = {KSP} } @InBook{ cfps2006, author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, editor = {A. Quarteroni et al.}, title = {Complex Systems in Biomedicine}, chapter = {Computational Electrocardiology: mathematical and numerical modeling}, publisher = {Springer-Verlag}, pages = {187--241}, year = {2006}, petsc_uses = {KSP} } @InProceedings{ cfpst2007, author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, title = {Determining recovery times from transmembrane action potentials and unipolar electrograms in normal heart tissue}, booktitle = {FIMH07}, publisher = {Springer-Verlag}, volume = {4466}, pages = {139--149}, year = {2007}, petsc_uses = {KSP} } @Article{ seemann2010framework, title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain Equations Using PETSc}}, author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and D{\\"o}ssel, O.}, journal = {Progress in Industrial Mathematics at ECMI 2008}, pages = {363--369}, year = {2010}, publisher = {Springer}, petsc_uses = {KSP} } @InProceedings{ pft2005, author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with Intramural Heterogeneity}, booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, pages = {267--277}, editors = {A. Frangi et al.}, publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, year = {2005}, petsc_uses = {KSP} } @Article{ bgcp2005, author = {Boyce E. Griffith and Charles S. Peskin}, title = {On the order of accuracy of the immersed boundary method: Higher order convergence rates for sufficiently smooth problems}, journal = {Journal of Computational Physics}, year = {2005}, volume = {208}, pages = {75--105}, petsc_uses = {KSP} } @Article{ griffith2007adaptive, title = {An adaptive, formally second order accurate version of the immersed boundary method}, author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, journal = {Journal of Computational Physics}, volume = {223}, number = {1}, pages = {10--49}, year = {2007}, publisher = {Elsevier}, petsc_uses = {KSP} } @PhDThesis{ griffith05, author = {Boyce Griffith}, title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and parallel version of the immersed boundary method}, school = {New York University}, year = {2005}, petsc_uses = {KSP} } @PhDThesis{ murillo, author = {Maria S. Murillo}, title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial Differential Equations with an Application in Computational Biology}, school = {University of Colorado at Boulder}, year = {2002}, petsc_uses = {KSP} } @Article{ spv2004, author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, title = {Parallel multigrid preconditioner for the cardiac bidomain model}, journal = {IEEE Trans. Biomed. Eng}, year = {2004}, volume = {51}, pages = {1960--1968}, petsc_uses = {KSP} } @Article{ vphl2003, author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, journal = {J. Electrocardiol.}, year = {2003}, volume = {36}, pages = {69--74}, petsc_uses = {KSP} } @InProceedings{ spbv2003, author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and E.J. Vigmond}, title = {Preconditioning Techniques for the Bidomain Equations}, booktitle = {Proceedings of the 15th International Conference on Domain Decomposition Methods}, pages = {571--580}, publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, note = {}, url = {http://www.ddm.org/DD15/proceedings-dd15.html}, year = {2003}, petsc_uses = {KSP} } @Article{ franz-pavir-04, author = {P. Colli Franzone and L.~F. Pavarino}, title = {A parallel solver for reaction-diffusion systems in computational electrocardiology}, journal = {Mathematical Models and Methods in Applied Sciences}, year = {2004}, volume = {14}, number = {6}, pages = {883--912}, petsc_uses = {KSP} } @Article{ franz-pavir-05, author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, title = {Simulating patterns of excitation, repolarization and action potential durationwith cardiac Bidomain and Monodomain models}, journal = {Mathematical Biosciences}, year = {2005}, volume = {197}, number = {1}, pages = {35--66}, petsc_uses = {KSP} } @Article{ franz-pavir-06, author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, title = {Effects of transmural electrical heterogeneities and electrotonic interactions on the dispersion of cardiac repolarization and action potential duration: a simulation study}, journal = {Mathematical Biosciences}, year = {2006}, volume = {204}, number = {1}, pages = {132--165}, petsc_uses = {KSP} } @InProceedings{ colli-franz-sim, author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X Mediterranean Conference on Medical and Biological Engineering}, url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ pf2003, author = {Luca F. Pavarino and Piero Colli Franzone}, title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, booktitle = {Proceedings of the 15th International Conference on Domain Decomposition Methods}, pages = {669--776}, publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, note = {}, url = {http://www.ddm.org/DD15/proceedings-dd15.html}, year = {2003}, petsc_uses = {KSP} } @Article{ maria-is04, author = {Maria Murillo and Xiao-Chuan Cai}, title = {A fully implicit parallel algorithm for simulating the non-linear electrical activity of the heart}, journal = {Numerical Linear Algebra with Applications}, year = {2004}, volume = {11}, pages = {261 - 277}, url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, petsc_uses = {KSP} } @Article{ murli2007monitoring, title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical Imaging in a Grid computing PSE}}, author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. and Lapegna, M.}, journal = {Grid-Based Problem Solving Environments}, pages = {421--432}, year = {2007}, publisher = {Springer}, petsc_uses = {KSP} } @Article{ carracciuolo:2006:tpc, author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, title = {Towards a parallel component for imaging in {PETSc} programming environment: a case study in {3-D} echocardiography}, journal = {Parallel Comput.}, volume = {32}, issue = {1}, month = jan, year = {2006}, issn = {0167-8191}, pages = {67--83}, numpages = {17}, doi = {10.1016/j.parco.2005.09.001}, acmid = {1141218}, publisher = {Elsevier Science Publishers B. V.}, address = {Amsterdam, The Netherlands, The Netherlands}, keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel component}, petsc_uses = {KSP} } @Article{ damore2011integration, title = {Integration of emerging computer technologies for an efficient image sequences analysis}, journal = {Integrated Computer-Aided Engineering }, volume = {18}, number = {4}, pages = {365 - 378}, year = {2011}, note = {}, issn = {1875-8835}, doi = {10.3233/ICA-2011-0382}, url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, petsc_uses = {KSP} } @InProceedings{ eth_biwi_00721, author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and G. Székely}, title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using a {S}chur Complement Preconditioner}, booktitle = {Euro-Par 2009 Parallel Processing}, year = {2009}, month = aug, pages = {747-759}, volume = {5704}, editor = {H. Sips and D. Epema and H.-X. Lin}, series = {Lecture Notes in Computer Science}, publisher = {Springer}, keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, parallel Krylov solver}, petsc_uses = {KSP} } % LiteralHTML:
% LiteralHTML:
% LiteralHTML:
@Article{ ganser2004deformable, title = {A deformable digital brain atlas system according to Talairach and Tournoux}, author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, journal = {Medical Image Analysis}, volume = {8}, number = {1}, pages = {3--22}, year = {2004}, publisher = {Elsevier}, petsc_uses = {KSP} } @Unpublished{ taccsurgery, title = {{TACC} supercomputer performs laser cancer surgery on canine}, url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in Austin performed laser surgery on a dog in Houston without the intervention of a surgeon. The treatment was developed collaboratively by computational experts from the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, leading technologists from the M.D. Anderson Cancer Center in Houston, and cyberinfrastructure specialists and systems from TACC. Using precise lasers, state-of-the-art thermal imaging technology, and advanced computational methods, dynamic, data-driven treatments are being pursued as a minimally invasive alternative to the standard treatment of cancer.}, petsc_uses = {KSP} } @Article{ ffhbresso2008, author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. Tinsley Oden}, title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, journal = {Engineering with Computers}, note = {Special issue on Computational Bioengineering}, year = {2008}, url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, petsc_uses = {KSP} } @TechReport{ dobbhbbbdeffghkkps2008, author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon and S. Prudhomme and R. J. Stafford}, title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of Cancer}, year = {2008}, institution = {University of Texas at Austin}, url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, petsc_uses = {KSP} } @Article{ ogdb2004, author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, journal = {Physics in Medicine and Biology}, year = {2004}, volume = {49}, pages = {2955--2947}, petsc_uses = {KSP} } @InProceedings{ majumdar11, author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. Baldridge and P. Krysl}, title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, booktitle = {ICCS 2005}, pages = {672--679}, editor = {V.S. Sunderam et al.}, year = {2005}, petsc_uses = {KSP} } @Conference{ sermesant-etal:03, author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and Ayache, H.}, title = {A parallel implementation of non-rigid registration using a volumetric biomechanical model}, booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, address = {Philadelphia, PA, USA}, publisher = {Springer-Verlag}, editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, series = {Lecture Notes in Computer Science}, volume = {2717}, pages = {398-407}, date = {june 23-24}, year = {2003}, url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, petsc_uses = {KSP} } @Conference{ sermesant-etal:04, author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. Wolfson and M. Shenton and H. Handels and R. Kikinis}, title = {A Novel Nonrigid Registration Algorithm And Applications}, booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, address = {Philadelphia, PA, USA}, publisher = {Springer-Verlag}, editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, series = {Lecture Notes in Computer Science}, volume = {2208}, pages = {923}, year = {2003}, url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, petsc_uses = {KSP} } @Article{ warfield-haker-talos-05, author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's hospital}, journal = {Medical Image Analysis}, url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, year = {2005}, petsc_uses = {KSP} } @Article{ brain3, author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of Deformation during Image Guided Neurosurgery}, journal = {Computing and Visualization in Science}, url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, year = {2002}, petsc_uses = {KSP} } @Article{ brain2, author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron Kikinis and Simon K. Warfield}, title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite Element Biomechanical Model}, journal = {IEEE Transactions on Medical Imaging}, url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, year = {2001}, petsc_uses = {KSP} } @InProceedings{ brain1, author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and Ferenc A. Jolesz and Ron Kikinis}, title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image Guided Neurosurgery}, booktitle = {Proceedings of SC2000}, url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, year = {2000}, petsc_uses = {KSP} } @Article{ vanne06, author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and M. Lassas and M. Kalke}, title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, journal = {IEEE Transactions on Medical Imaging}, volume = {25}, number = {2}, month = feb, year = {2006}, pages = {218--228}, petsc_uses = {KSP} } @InProceedings{ knepleybardhan2015, title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, author = {Matthew G. Knepley and Jaydeep P. Bardhan}, booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& Exposition}, volume = {9}, pages = {V009T12A04}, doi = {10.1115/IMECE2015-53579}, year = {2015}, petsc_uses = {KSP} } @InProceedings{ bardhanknepley2015, title = {Multiscale models and approximation algorithms for protein electrostatics}, author = {Jaydeep P. Bardhan and Matthew G. Knepley}, booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, volume = {61}, pages = {163--174}, url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, doi = {10.2495/BEM380131}, publisher = {WIT Press}, year = {2015}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Fusion

% LiteralHTML: @InProceedings{ adamsbrennanknepleywang2022, title = {{Landau} collision operator in the {CUDA} programming model applied to thermal quench plasmas}, author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference (IPDPS '22)}, doi = {10.1109/IPDPS53621.2022.00020}, year = {2022}, petsc_uses = {DMPlex} } @Misc{ adamsknepleybrennan2021, title = {Runaway Electron Generation with High-Performance, Structure Preserving Discretization of {F}okker--{P}lank--{L}andau}, author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, year = {2021}, petsc_uses = {KSP} } @Article{ adamshirvijokiknepleybrownisaacmills2017, title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging Architectures}, author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin Isaac and Richard Mills}, journal = {SIAM Journal on Scientific Computing}, volume = {39}, number = {6}, pages = {C452--C465}, doi = {10.1137/17M1118828}, eprint = {1702.08880}, year = {2017}, petsc_uses = {KSP} } @Article{ pusztayknepleyadams2022, title = {Conservative Projection Between {FEM} and Particle Bases}, author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, journal = {SIAM Journal on Scientific Computing}, volume = {44}, number = {4}, pages = {C310--C319}, doi = {10.1137/21M145407}, year = {2022} } @Article{ hirvijoki2017, author = {Eero Hirvijoki and Mark F. Adams}, title = {Conservative discretization of the {Landau} collision integral}, journal = {Physics of Plasmas}, volume = {24}, number = {3}, pages = {032121}, doi = {10.1063/1.4979122}, year = {2017}, petsc_uses = {KSP} } @Article{ mollenadamsknepleyhagerchang2021, title = {Implementation of higher-order velocity mapping between marker particles and grid in the particle-in-cell code {XGC}}, author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. S. Chang}, journal = {Journal of Plasma Physics}, volume = {87}, number = {2}, pages = {905870229}, eprint = {2012.11764}, doi = {10.1017/S0022377821000441}, year = {2021}, petsc_uses = {KSP} } @Article{ lsmh2014, author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, title = {Comparison of particle trajectories and collision operators for collisional transport in nonaxisymmetric plasmas}, journal = { Physics of Plasmas}, volume = {21}, year = {2014}, petsc_uses = {KSP} } @Article{ lpcep2014, author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, title = {Radially global delta-f computation of neoclassical phenomena in a tokamak pedestal}, journal = {Plasma Physics and Controlled Fusion}, volume = {56}, year = {2014}, petsc_uses = {KSP} } @Article{ facets-scidac08, title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. Stotler and A. Pigarov}, journal = {J. Phys.: Conf. Ser.}, volume = {125}, year = {2008}, pages = {012040}, url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, petsc_uses = {KSP} } @Article{ facets-scidac09, title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar and A. Pigarov and H. Zhang}, journal = {J. Phys.: Conf. Ser.}, volume = {180}, year = {2009}, pages = {012056}, url = {http://iopscience.iop.org/1742-6596/180/1/012056}, petsc_uses = {KSP} } @InProceedings{ facets-scidac10, title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the {FACETS} Code}, author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. Pigarov and H. Zhang}, booktitle = {Proceedings of SciDAC 2010 Conference}, year = {2010}, url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, petsc_uses = {KSP} } @InProceedings{ facets-fec2010, title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using the {FACETS} Framework}, author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, Republic of Korea}, year = {2010}, petsc_uses = {KSP} } @InProceedings{ facets-epdp2010, title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. Groebner and S. Balay and L. McInnes and H. Zhang}, booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on Parallel, Distributed and Network-Based Computing), Pisa, Italy}, year = {2010}, petsc_uses = {KSP} } @Article{ carlssoncary09, author = {Johan Carlsson, John R. Cary}, title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse nonlinear systems}, journal = {arXiv}, year = {2009}, note = {http://arxiv.org/abs/0905.1054}, url = {http://arxiv.org/pdf/0905.1054v1}, petsc_uses = {KSP} } @InProceedings{ oshahjs2006, author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and S.J. Janhunen and T.P. Kiviniemi}, title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of application}, booktitle = {33rd EPS Conference on Plasma Phys.}, year = {2006}, url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, note = {European fusion code}, petsc_uses = {KSP} } @Article{ zhu2006, author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of convection-induced discontinuities and absence of finite-time singularities}, journal = {Phys. Rev. Lett.}, volume = {96}, number = {065001}, year = {2006}, doi = {10.1103/PhysRevLett.96.065001}, petsc_uses = {KSP} } @InProceedings{ ppc2005, author = {B. Philip and M. Pernice and L.Chacon}, title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh Refinement}, booktitle = {Proceedings of the 16th International Conference on Domain Decomposition methods}, year = {2005}, lab = {LANL}, petsc_uses = {KSP} } @Article{ pp2005, author = {M. Pernice and B. Philip}, title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh Refinement}, year = {2005}, journal = {SIAM J. of Sci. Comput.}, lab = {LANL}, petsc_uses = {KSP} } @Article{ gt2004, author = {A. H. Glasser and X. Z. Tang}, title = {The {SEL} macroscopic modeling code}, year = {2004}, journal = {Computer Physics Communications}, pages = {237--243}, volume = {164}, lab = {LANL}, petsc_uses = {KSP} } @Article{ nl2006, author = {Y. Nishimura and Z.Lin}, title = {A finite element mesh in a tokamak edge geometry}, year = {2006}, journal = {Contributions to Plasma Physics}, volume = {22}, lab = {PPPL}, petsc_uses = {KSP} } @Article{ nlle2004, author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global field aligned mesh}, year = {2006}, journal = {J. Comput. Phys.}, volume = {214}, pages = {657}, lab = {PPPL}, petsc_uses = {KSP} } @InProceedings{ lnlle2004, author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, year = {2004}, url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, lab = {PPPL}, petsc_uses = {KSP} } @InProceedings{ nlclew2004, author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron model}, booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, year = {2004}, url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, lab = {PPPL}, petsc_uses = {KSP} } @Article{ tb1, author = {X.~Z.~Tang and A.~H.~Boozer}, title = {Numerical studies of a steady state axisymmetric co-axial helicity injection plasma}, journal = {Physics of Plasmas}, year = {2004}, pages = {171--185}, volume = {11}, lab = {LANL}, petsc_uses = {KSP} } @Unpublished{ nlcw, title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, Albuquerque, New Mexico, October 2003}, year = {2003}, petsc_uses = {KSP} } @TechReport{ tang2001, author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. Strauss}, title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, year = {2001}, institution = {Princeton Plasma Physics Laboratory}, number = {PPPL-3532}, url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, March 12-14, 2001.}, lab = {PPPL}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Geosciences

% LiteralHTML: @Article{ valerathomasgarciacastillo2019, author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear Coastal Ocean Model}, journal = {Journal of Marine Science and Engineering}, volume = {7}, number = {6}, article-number= {185}, url = {https://www.mdpi.com/2077-1312/7/6/185}, issn = {2077-1312}, doi = {10.3390/jmse7060185}, year = {2019}, petsc_uses = {KSP} } @Article{ furuichimat2015, title = {Implicit solution of the material transport in Stokes flow simulation: Toward thermal convection simulation surrounded by free surface}, author = {Mikito Furuichi and Dave A May}, journal = {Computer Physics Communications}, volume = {192}, pages = {1--11}, year = {2015}, petsc_uses = {KSP} } @Article{ sharplesmoresivelicjadamecmay2016, title = {Simulating faults and plate boundaries with a transversely isotropic plasticity model}, author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and Dave A May}, journal = {Physics of the Earth and Planetary Interiors}, volume = {252}, pages = {77--90}, year = {2016}, petsc_uses = {KSP} } @Article{ spiegelmanmaywilson2016, title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in geodynamics}, author = {Marc Spiegelman and Dave A May and Cian R Wilson}, journal = {Geochemistry, Geophysics, Geosystems}, volume = {17}, number = {6}, pages = {2213--2238}, year = {2016}, petsc_uses = {KSP} } @Article{ buiteretal2016, title = {Benchmarking numerical models of brittle thrust wedges}, author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook and Dave May and Pauline Souloumiac and Christopher Beaumont}, journal = {Journal of structural geology}, volume = {92}, pages = {140--177}, year = {2016}, petsc_uses = {KSP} } @Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, title = {Modular and flexible spectral-element waveform modelling in two and three dimensions}, author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, journal = {Geophysical Journal International}, volume = {216}, number = {3}, pages = {1675--1692}, doi = {10.1093/gji/ggy469}, year = {2019}, petsc_uses = {KSP} } @Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform Modeling}, author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and Andreas Fichtner}, journal = {SIAM Journal on Scientific Computing}, volume = {43}, number = {2}, pages = {C127--C153}, eprint = {http://arxiv.org/abs/2004.08729}, doi = {10.1137/20M1332748}, year = {2021}, petsc_uses = {KSP} } @Article{ parsani2021, title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} algorithms and flow solver}, author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, journal = {Journal of Computational Physics}, volume = {424}, pages = {109844}, issn = {0021-9991}, doi = {https://doi.org/10.1016/j.jcp.2020.109844}, url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, year = {2021}, petsc_uses = {KSP} } @Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems governed by {PDEs}}, author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, journal = {SIAM Journal of Scientific Computing}, volume = {42}, number = {5}, pages = {A3397--A3426}, year = {2020} } @Article{ zampinibouakaramturkiyyahkniokeyes2022, title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. Keyes}, journal = {Advances on Computational Mathematics}, note = {In press}, year = {2022} } @Article{ dassizampiniscacchi2022, title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element discretizations of elliptic equations in mixed form}, author = {F. Dassi and Stefano Zampini and S. Scacchi}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {391}, pages = {114620}, year = {2022} } @Article{ youngoppenheimdimant2017, author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the equatorial E region ionosphere}, journal = {Journal of Geophysical Research: Space Physics}, volume = {122}, number = {5}, issn = {2169-9402}, doi = {10.1002/2017JA024161}, pages = {5768--5781}, year = {2017}, petsc_uses = {KSP} } @Article{ rioussetpatylillisfillingimenglandwithershale2013, title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' dynamo region}, author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim and Scott L England and Paul G Withers and John P M Hale}, journal = {Journal of Geophysical Research: Space Physics}, volume = {118}, number = {6}, pages = {3647--3659}, year = {2013}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @Article{ chien2016representation, title = {Representation of topography by partial steps using the immersed boundary method in a vector vorticity equation model (VVM)}, author = {Chien, Mu-Hua and Wu, Chien-Ming}, journal = {Journal of Advances in Modeling Earth Systems}, year = {2016}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @Article{ berger2015parallel, title = {Parallel preconditioners for monolithic solution of shear bands}, author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, journal = {Journal of Computational Physics}, year = {2015}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ may2015496, title = {A scalable, matrix-free multigrid preconditioner for finite element discretizations of heterogeneous {S}tokes flow }, journal = {Computer Methods in Applied Mechanics and Engineering }, volume = {290}, number = {0}, pages = {496--523}, year = {2015}, issn = {0045-7825}, doi = {10.1016/j.cma.2015.03.014}, author = {D.A. May and J. Brown and L. {Le Pourhiet}}, petsc_uses = {KSP} } @Article{ isaacknepley2017, title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, author = {Tobin Isaac and Matthew G. Knepley}, journal = {ArXiv e-prints}, eprint = {1508.02470}, year = {2017}, note = {\url{http://arxiv.org/abs/1508.02470}}, petsc_uses = {DMPlex} } @Article{ knepleylangegorman2017, title = {Unstructured Overlapping Mesh Distribution in Parallel}, author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, journal = {ArXiv e-prints}, eprint = {1506.06194}, year = {2017}, note = {\url{http://arxiv.org/abs/1506.06194}}, petsc_uses = {DMPlex} } @Article{ langemitchellknepleygorman2015, title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, journal = {SIAM Journal on Scientific Computing}, volume = {38}, number = {5}, pages = {S143--S155}, eprint = {http://arxiv.org/abs/1506.07749}, doi = {10.1137/15M1026092}, year = {2016}, petsc_uses = {DMPlex} } @InProceedings{ langeknepleygorman2015, title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, booktitle = {Proceedings of the Exascale Applications and Software Conference}, month = apr, url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, year = {2015}, petsc_uses = {DMPlex} } @InProceedings{ wallworkknepleybarralpiggott2022, title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. Piggott}, booktitle = {SIAM International Meshing Roundtable Workshop 2022}, editor = {Trevor Robinson}, month = jan, address = {Seattle, WA}, pages = {1--5}, url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, year = {2022}, petsc_uses = {DMPlex} } @InProceedings{ timalsinaknepley2023, title = {Tetrahedralization of a Hexahedral Mesh}, author = {Aman Timalsina and Matthew G. Knepley}, booktitle = {SIAM International Meshing Roundtable Workshop 2023}, year = {2023}, petsc_uses = {DMPlex} } @Article{ farrellknepleywechsungmitchell2020, title = {{PCPATCH}: software for the topological construction of multigrid relaxation methods}, author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian Wechsung}, journal = {ACM Transaction on Mathematical Software}, eprint = {http://arxiv.org/abs/1912.08516}, volume = {47}, number = {3}, pages = {1--22}, issn = {0098-3500}, doi = {10.1145/3445791}, publisher = {Association for Computing Machinery}, issue_date = {September 2021}, year = {2021}, petsc_uses = {KSP,DMPlex} } @Article{ laakmann2022augmented, title = {An augmented Lagrangian preconditioner for the magnetohydrodynamics equations at high Reynolds and coupling numbers}, author = {Fabian Laakmann and Patrick E Farrell and Lawrence Mitchell}, journal = {SIAM Journal on Scientific Computing}, volume = {44}, number = {4}, pages = {B1018--B1044}, year = {2022} } @Article{ papadopoulosfarrellsurowiec2021, title = {Computing multiple solutions of topology optimization problems}, author = {Papadopoulos, Ioannis PA and Farrell, Patrick E and Surowiec, Thomas M}, journal = {SIAM Journal on Scientific Computing}, volume = {43}, number = {3}, pages = {A1555--A1582}, year = {2021} } @Article{ jiangzhanghuschneiderzorinpanozzo2021, title = {Bijective and coarse high-order tetrahedral meshes}, author = {Jiang, Zhongshi and Zhang, Ziyi and Hu, Yixin and Schneider, Teseo and Zorin, Denis and Panozzo, Daniele}, journal = {ACM Transactions on Graphics (TOG)}, volume = {40}, number = {4}, pages = {1--16}, year = {2021} } @Article{ abumaclachlanfarrell2023, title = {Monolithic multigrid for implicit {Runge--Kutta} discretizations of incompressible fluid flow}, author = {Abu-Labdeh, Razan and MacLachlan, Scott and Farrell, Patrick E}, journal = {Journal of Computational Physics}, volume = {478}, pages = {111961}, year = {2023} } @Article{ farrellkirbymarchena2021, title = {{Irksome}: Automating {Runge--Kutta} time-stepping for finite element methods}, author = {Farrell, Patrick E and Kirby, Robert C and Marchena-Menendez, Jorge}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {47}, number = {4}, pages = {1--26}, year = {2021} } @Article{ farrellgazca2020, title = {An augmented Lagrangian preconditioner for implicitly constituted non-Newtonian incompressible flow}, author = {Farrell, Patrick E and Gazca-Orozco, Pablo Alexei}, journal = {SIAM Journal on Scientific Computing}, volume = {42}, number = {6}, pages = {B1329--B1349}, year = {2020} } @Article{ farrellmitchellscottwechsung2022, title = {Robust multigrid methods for nearly incompressible elasticity using macro elements}, author = {Farrell, Patrick E and Mitchell, Lawrence and Scott, L Ridgway and Wechsung, Florian}, journal = {IMA Journal of Numerical Analysis}, volume = {42}, number = {4}, pages = {3306--3329}, year = {2022} } @Article{ shihstadlerwechsung2022, title = {Robust multigrid techniques for augmented Lagrangian preconditioning of incompressible Stokes equations with extreme viscosity variations}, author = {Shih, Yu-hsuan and Stadler, Georg and Wechsung, Florian}, journal = {SIAM Journal on Scientific Computing}, volume = {45}, number = {3}, pages = {S27--S53}, year = {2022} } @Article{ adlerhehumaclachlanohm2022, title = {Monolithic multigrid for a reduced-quadrature discretization of poroelasticity}, author = {Adler, James H and He, Yunhui and Hu, Xiaozhe and MacLachlan, Scott and Ohm, Peter}, journal = {SIAM Journal on Scientific Computing}, volume = {45}, number = {3}, pages = {S54--S81}, year = {2022} } @Article{ xiafarrellwechsung2021, title = {Augmented Lagrangian preconditioners for the Oseen--Frank model of nematic and cholesteric liquid crystals}, author = {Xia, Jingmin and Farrell, Patrick E and Wechsung, Florian}, journal = {BIT Numerical Mathematics}, volume = {61}, pages = {607--644}, year = {2021} } @Article{ budisahukuchtamardalzikatanov2023, title = {Algebraic multigrid methods for metric-perturbed coupled problems}, author = {Budisa, Ana and Hu, Xiaozhe and Kuchta, Miroslav and Mardal, Kent-Andre and Zikatanov, Ludmil Tomov}, journal = {arXiv preprint arXiv:2305.06073}, year = {2023} } @Article{ laakmannhufarrell2023, title = {Structure-preserving and helicity-conserving finite element approximations and preconditioning for the Hall MHD equations}, author = {Laakmann, Fabian and Hu, Kaibo and Farrell, Patrick E}, journal = {Journal of Computational Physics}, volume = {492}, pages = {112410}, year = {2023} } @Article{ hongkrauskuchtalymberymardalrognes2022, title = {Robust approximation of generalized Biot-Brinkman problems}, author = {Hong, Qingguo and Kraus, Johannes and Kuchta, Miroslav and Lymbery, Maria and Mardal, Kent-Andr{\'e} and Rognes, Marie E}, journal = {Journal of Scientific Computing}, volume = {93}, number = {3}, pages = {77}, year = {2022} } @Article{ boonkuchtamardalruiz2021, title = {Robust preconditioners for perturbed saddle-point problems and conservative discretizations of {Biot's} equations utilizing total pressure}, author = {Boon, Wietse M and Kuchta, Miroslav and Mardal, Kent-Andre and Ruiz-Baier, Ricardo}, journal = {SIAM Journal on Scientific Computing}, volume = {43}, number = {4}, pages = {B961--B983}, year = {2021} } @Article{ papadopoulosfarrell2023, title = {Preconditioners for computing multiple solutions in three-dimensional fluid topology optimization}, author = {Papadopoulos, Ioannis PA and Farrell, Patrick E}, journal = {SIAM Journal on Scientific Computing}, volume = {45}, number = {6}, pages = {B853--B883}, year = {2023} } @Article{ farrellhamdanmaclachlan2022, title = {A new mixed finite-element method for H2 elliptic problems}, author = {Farrell, Patrick E and Hamdan, Abdalaziz and MacLachlan, Scott P}, journal = {Computers \& Mathematics with Applications}, volume = {128}, pages = {300--319}, year = {2022} } @Article{ harpertuminaro2023, title = {Compression and Reduced Representation Techniques for Patch-Based Relaxation}, author = {Harper, Graham and Tuminaro, Ray}, journal = {arXiv preprint arXiv:2306.10025}, year = {2023} } @Article{ kirbykernell2021, title = {Preconditioning mixed finite elements for tide models}, author = {Kirby, Robert C and Kernell, Tate}, journal = {Computers \& Mathematics with Applications}, volume = {82}, pages = {212--227}, year = {2021} } @Book{ xia2023, title = {Computing and Analysing Energy Minimisation Problems in Liquid Crystals: Implementation Using Firedrake}, author = {Xia, Jingmin}, year = {2023}, publisher = {World Scientific} } @PhDThesis{ leveque2022, title = {Preconditioned iterative methods for optimal control problems with time-dependent PDEs as constraints}, author = {Leveque, Santolo}, school = {The University of Edinburgh}, year = {2022} } @PhDThesis{ brubeck2022, title = {Optimal-complexity and robust multigrid methods for high-order FEM}, author = {Pablo D. Brubeck}, school = {Oxford University}, year = {2022} } @Misc{ firedrakeproject, title = {{The {F}iredrake project}}, author = {David A Ham and Firedrake Team}, url = {http://firedrakeproject.org}, year = {2022}, petsc_uses = {KSP} } @Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, title = {Firedrake: automating the finite element method by composing abstractions}, author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall and Paul HJ Kelly}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {43}, number = {3}, pages = {24}, year = {2016}, petsc_uses = {KSP} } @Article{ mitchellmuller2016, title = {High level implementation of geometric multigrid solvers for finite element problems: Applications in atmospheric modelling}, author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, journal = {Journal of Computational Physics}, volume = {327}, pages = {1--18}, year = {2016}, petsc_uses = {KSP} } @Article{ mcraeberceamitchellhamcotter2016, title = {Automated generation and symbolic manipulation of tensor product finite elements}, author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham and Colin J Cotter}, journal = {SIAM Journal on Scientific Computing}, volume = {38}, number = {5}, pages = {S25--S47}, year = {2016}, petsc_uses = {KSP} } @Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, title = {A structure-exploiting numbering algorithm for finite elements on extruded meshes, and its performance evaluation in {Firedrake}}, author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, journal = {Geoscientific Model Development}, volume = {9}, number = {10}, pages = {3803--3815}, doi = {10.5194/gmd-9-3803-2016}, year = {2016}, petsc_uses = {KSP} } @InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, publisher = {Springer Berlin Heidelberg}, pages = {279--289}, isbn = {978-3-642-38750-0}, doi = {10.1007/978-3-642-38750-0_21}, year = {2013}, petsc_uses = {KSP} } @Article{ kirbymitchell2017, title = {Solver composition across the {PDE}/linear algebra barrier}, author = {Robert C Kirby and Lawrence Mitchell}, journal = {arXiv preprint arXiv:1706.01346}, year = {2017}, petsc_uses = {KSP} } @Article{ saibaba2012application, title = {Application of hierarchical matrices to linear inverse problems in geostatistics}, author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, Peter K and Darve, Eric F}, journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, volume = {67}, number = {5}, pages = {857}, year = {2012}, petsc_uses = {KSP} } @Article{ collignonkausmayfernandez14, author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, title = {Influences of surface processes on fold growth during {3-D} detachment folding}, journal = {Geochem Geophy Geosy}, year = {2014}, petsc_uses = {KSP} } @Article{ fernandezkaus14, author = {Fern\'andez, N. and Kaus, B.}, title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment folding}, journal = {Tectonophysics}, year = {2014}, petsc_uses = {KSP} } @Article{ baumannkauspopov14, author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, title = {Constraining effective rheology through parallel joint geodynamic inversion}, journal = {Tectonophysics}, year = {2014}, petsc_uses = {KSP} } @Article{ lechmannschmalholzhetenyimaykaus14, author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. J. P.}, title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics of the modern {India-Asia} collisional system with {3-D} numerical models}, journal = { Journal of Geophysical Research - Solid Earth}, year = {2014}, petsc_uses = {KSP} } @InBook{ fernandezkaus14b, author = {Fern\'andez N. and Kaus B.J.P.}, title = {Analytical and numerical investigation of {3D} multilayer detachment}, booktitle = {Mathematics of Planet Earth}, editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. and Dur\'an J.J. and Vargas-Guzman J.A.}, publisher = {Springer}, year = {2014}, petsc_uses = {KSP} } @Article{ hossein-hsueh-etal-2014a, author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, journal = {J. Mech. Phys. Solids}, pages = {320--348}, title = {Effective toughness of heterogeneous media}, volume = {71}, year = {2014}, petsc_uses = {KSP} } @Unpublished{ leon-baldelli-bourdin-2014a, author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, month = aug, note = {Submitted.}, title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, year = {2014}, petsc_uses = {KSP} } @Article{ leon-baldelli-babadjian-etal-2013a, author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and Maurini, C.}, journal = {J. Mech. Phys. Solids}, pages = {15-32}, title = {A Variational Model For Fracture And Delamination Of Thin Films}, volume = {70}, year = {2014}, petsc_uses = {KSP} } @Article{ mesgarnejad-bourdin-etal-2014a, author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, journal = {Comp. Methods Appl. Mech. Engng.}, title = {Validation simulations for the variational approach to fracture}, volume = {Submitted}, year = {2014}, petsc_uses = {KSP} } @InProceedings{ bourdin-chukwudozie-etal-2013a, author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford University, Stanford, CA}, title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic Fracturing Under In-Situ Stresses}, year = {2013}, petsc_uses = {KSP} } @Article{ maurini-bourdin-etal-2012a, author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, journal = {Int. J. Fracture}, number = {1-2}, pages = {75-91}, title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a capillary tube: experiments and numerical simulations using a two-dimensional variational approach}, volume = {184}, year = {2013}, petsc_uses = {KSP} } @Article{ mesgarnejad-bourdin-etal-2013a, author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, journal = {J. Mech. Phys Solids}, number = {11}, pages = {2360--2379}, title = {A variational approach to the fracture of brittle thin films under out of plane loading}, volume = {61}, year = {2013}, petsc_uses = {KSP} } @InProceedings{ bourdin-chukwudozie-etal-2012a, author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, volume = {SPE 159154}, year = {2012}, petsc_uses = {KSP} } @Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter Langtangen}, title = {Numerical simulation of water resources problems: Models, methods, and trends}, journal = {Advances in Water Resources}, volume = {51}, number = {0}, pages = {405--437}, year = {2013}, note = {35th Year Anniversary Issue}, issn = {0309-1708}, doi = {10.1016/j.advwatres.2012.05.008}, petsc_uses = {KSP} } @Article{ scheltingamyerspietrzak10, author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, journal = {Ocean Dynamics}, volume = {60}, number = {6}, pages = {1539-1558}, year = {2010}, issn = {1616-7341}, doi = {10.1007/s10236-010-0356-5}, publisher = {Springer-Verlag}, keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic Archipelago; Freshwater flux}, language = {English}, petsc_uses = {KSP} } @InBook{ destefanoandreasisecchi13, author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical inversions}, booktitle = {SEG Technical Program Expanded Abstracts 2013}, chapter = {626}, pages = {3226--3230}, doi = {10.1190/segam2013-0244.1}, url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, petsc_uses = {KSP} } @Article{ pourhiethuetmaylabroussejolivet12, author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, journal = {Geochem. Geophys. Geosyst.}, volume = {13}, pages = {Q09002}, year = {2012}, doi = {10.1029/2012GC004271}, petsc_uses = {KSP} } @Article{ lechmannmaykausschmalholz11, author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, title = {Comparing thin-sheet models with {3-D} multilayer models for continental collision}, journal = {Geophysical Journal International}, volume = {187}, pages = {10--33}, year = {2011}, doi = {10.1111/j.1365-246X.2011.05164.x}, petsc_uses = {KSP} } @Article{ stefano:r69, author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo Virgilio and Fred F. Snyder}, collaboration = {}, title = {Multiple-domain, simultaneous joint inversion of geophysical data with application to subsalt imaging}, publisher = {SEG}, year = {2011}, journal = {Geophysics}, volume = {76}, number = {3}, pages = {R69-R80}, keywords = {geophysical image processing; inverse problems; seismology}, doi = {10.1190/1.3554652}, petsc_uses = {KSP} } @Article{ stefano:806, author = {Michele De Stefano}, collaboration = {}, title = {Simultaneous joint inversion for susceptibility and velocity}, publisher = {SEG}, year = {2011}, journal = {SEG Technical Program Expanded Abstracts}, volume = {30}, number = {1}, pages = {806-810}, keywords = {3D; imaging; inversion; magnetics; multiparameter}, doi = {10.1190/1.3628198}, petsc_uses = {KSP} } @Article{ mayknepley2011, author = {Dave A. May and Matthew G. Knepley}, title = {Optimal, scalable forward models for computing gravity anomalies}, journal = {Geophysical Journal International}, volume = {187}, number = {1}, pages = {161--177}, url = {http://arxiv.org/abs/1107.5951}, note = {\url{http://arxiv.org/abs/1107.5951}}, year = {2011}, petsc_uses = {KSP} } @InProceedings{ bourdinknepleymaurini2010, author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, address = {Stanford, CA}, year = {2010}, petsc_uses = {KSP} } @InProceedings{ bourdinknepleymaurini2010b, author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, address = {Sacramento, CA}, year = {2010}, petsc_uses = {KSP} } @Article{ chen2007full, title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, author = {Chen, P. and Zhao, L. and Jordan, T.H.}, journal = {Bulletin of the Seismological Society of America}, volume = {97}, number = {4}, pages = {1094}, year = {2007}, publisher = {Seismol Soc America}, petsc_uses = {KSP} } @Article{ brown2010ens, author = {Brown, Jed}, affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, Zürich, Switzerland}, title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, journal = {Journal of Scientific Computing}, publisher = {Springer Netherlands}, issn = {0885-7474}, keyword = {Mathematics and Statistics}, pages = {48-63}, volume = {45}, issue = {1}, doi = {10.1007/s10915-010-9396-8}, year = {2010}, petsc_uses = {KSP} } @PhDThesis{ brown2011, title = {Computational methods for ice flow simulation}, author = {Jed Brown}, school = {ETH Z{\"u}rich}, year = {2011}, petsc_uses = {KSP} } @Article{ brown2013tmeice, title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, journal = {SIAM Journal on Scientific Computing}, volume = {35}, number = {2}, year = {2013}, pages = {359--375}, doi = {10.1137/110834512}, note = {Also preprint ANL/MCS-P743-1298}, petsc_uses = {KSP} } @InProceedings{ brown2013quasinewton, author = {Jed Brown and Peter Brune}, title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type methods}, year = {2013}, booktitle = {International Conference on Mathematics and Computational Methods Applied to Nuclear Science and Engineering}, pages = {2554--2565}, petsc_uses = {KSP} } @Misc{ spiegelman-siampp10, title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid Earth Geodynamics}, author = {Marc Spiegelman}, note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific Computing}, year = {2010}, petsc_uses = {KSP} } @Article{ schauer2011a, author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. Quintana-Ort\'{\i}}, title = {Large scale simulation of wave propagation in soils interacting with structures using {FEM} and {SBFEM}}, journal = {Journal of Computational Acoustics}, volume = {19}, number = {1}, pages = {75--93}, year = {2011}, doi = {10.1142/S0218396X11004316}, petsc_uses = {KSP} } @Misc{ bsa2010, author = {J. Brown and B. Smith and A. Ahmadia}, title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, note = {submitted to SIAM Journal on Scientific Computing}, year = {2012}, petsc_uses = {KSP} } @Article{ kellerkatz2016, title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, author = {Tobias Keller and Richard F. Katz}, journal = {Journal of Petrology}, doi = {10.1093/petrology/egw030}, url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, year = {2016}, petsc_uses = {KSP} } @Article{ weatherley12, author = {S. Weatherley and R.F. Katz}, title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling mantle}, journal = {Geochem.\ Geophys.\ Geosys.}, year = {2012}, volume = {13}, number = {1}, pages = {Q0AC18}, doi = {10.1029/2011GC003989}, petsc_uses = {KSP} } @Article{ katz12, author = {R.F. Katz and S. Weatherley}, title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, journal = {Earth\ Planet.\ Sci.\ Lett.}, year = {2012}, doi = {10.1016/j.epsl.2012.04.042}, volume = {335-336}, pages = {226-237}, petsc_uses = {KSP} } @Article{ katz10b, author = {R.F. Katz}, title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, journal = {Geochem.\ Geophys.\ Geosys.}, volume = {10}, number = {Q0AC07}, year = {2010}, doi = {10.1029/2010GC003282}, petsc_uses = {KSP} } @Article{ england10, author = {P.C. England and R.F. Katz}, title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, journal = {Nature}, year = {2010}, volume = {467}, pages = {700--703}, doi = {10.1038/nature09417}, petsc_uses = {KSP} } @Article{ weatherley10, author = {S. Weatherley and R.F. Katz}, title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, journal = {Geochem.\ Geophys.\ Geosys.}, year = {2010}, volume = {11}, number = {10}, doi = {10.1029/2010GC003192}, petsc_uses = {KSP} } @Article{ katz10, author = {R.F. Katz and M.G. Worster}, title = {The stability of ice-sheet grounding lines}, journal = {Proc.~Roy.~Soc.~A}, year = {2010}, volume = {466}, pages = {1597--1620}, doi = {10.1098/rspa.2009.0434}, url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, petsc_uses = {KSP} } @Article{ kyrkesmith2013stress, title = {Stress balances of ice streams in a vertically integrated, higher-order formulation}, author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, journal = {Journal of Glaciology}, volume = {59}, number = {215}, pages = {449--466}, year = {2013}, doi = {10.3189/2013JoG12J140}, petsc_uses = {KSP} } @Article{ takei2013anisotropy1, author = {Takei Y. and R.F. Katz}, title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. Governing equations and linearised analysis}}, journal = {J.\ Fluid\ Mech.}, year = {2013}, volume = {734}, pages = {424-455}, doi = {10.1017/jfm.2013.482}, petsc_uses = {KSP} } @Article{ katz2013anisotropy2, author = {Katz R.F. and Y. Takei}, title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. Numerical solutions of the full equations}}, journal = {J.\ Fluid\ Mech.}, year = {2013}, volume = {734}, pages = {456-485}, doi = {10.1017/jfm.2013.483}, petsc_uses = {KSP} } @Article{ kyrke-smith2014subglacial, author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, title = {Subglacial hydrology and the formation of ice streams}, journal = {Proc.\ Roy.\ Soc.\ A}, year = {2014}, volume = {470}, number = {2161}, doi = {10.1098/rspa.2013.0494}, petsc_uses = {KSP} } @Article{ spiegelmanwilsonvankeken2013, author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for multi-physics problems in the solid Earth sciences}}, journal = {AGU Fall Meeting Abstracts}, keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, year = {2013}, month = dec, pages = {A2208}, adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, adsnote = {Provided by the SAO/NASA Astrophysics Data System}, petsc_uses = {KSP} } @Article{ bueler2009shallow, title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled ice sheet model}}, author = {Ed Bueler and Jed Brown}, journal = {Journal of Geophysical Research-Earth Surface}, volume = {114}, number = {F3}, pages = {F03008}, year = {2009}, publisher = {American Geophysical Union}, petsc_uses = {KSP} } @Article{ bueler2007est, title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: effective tools for verification}}, author = {Ed Bueler and Jed Brown and Craig Lingle}, journal = {J. Glaciol}, volume = {53}, pages = {499--516}, year = {2007}, petsc_uses = {KSP} } @Article{ bueler2007fcv, title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet simulations}}, author = {Ed Bueler and Craig S. Lingle and Jed Brown}, journal = {Ann. Glaciol}, volume = {46}, pages = {97--105}, year = {2007}, petsc_uses = {KSP} } @Article{ bueler2005iso, author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and Latrice N. Bowman}, title = {Exact solutions and numerical verification for isothermal ice sheets}, journal = {J. Glaciol.}, volume = {51}, number = {173}, pages = {291--306}, year = {2005}, petsc_uses = {KSP} } @Article{ chao2008programming, title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, author = {Chao-fan, Z. and Yao-lin, S.}, journal = {Earthquake}, year = {2008}, petsc_uses = {KSP} } @Article{ marti2014, author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, title = {Full sphere hydrodynamic and dynamo benchmarks}, journal = {Geophysical Journal International}, year = {2014}, doi = {10.1093/gji/ggt518}, url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, petsc_uses = {KSP} } @InProceedings{ ganfulukyangxueyang2013, author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, Guangwen}, title = {Global Atmospheric Simulation on a Reconfigurable Platform}, booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on Field-Programmable Custom Computing Machines}, series = {FCCM '13}, pages = {230--}, year = {2013}, isbn = {978-0-7695-4969-9}, doi = {10.1109/FCCM.2013.26}, acmid = {2495688}, publisher = {IEEE Computer Society}, petsc_uses = {KSP} } @InProceedings{ ganfuchaolukxuemencerhuangyang2014, author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and Xiaomeng Huang and Guangwen Yang}, booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International Conference on}, title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric equations}, year = {2014}, month = sep, pages = {1-6}, doi = {10.1109/FPL.2014.6927462}, petsc_uses = {KSP} } %Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. %Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. %Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. @Article{ aagaardknepleywilliams13, title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element Models of Quasi-static and Dynamic Crustal Deformation}, author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {118}, number = {6}, pages = {3059--3079}, issn = {2169-9356}, doi = {10.1002/jgrb.50217}, keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, year = {2013}, petsc_uses = {KSP} } @InProceedings{ aagaardknepleywilliams11, author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, note = {Fall Meeting Supplemental, Abstract DI14A-08}, year = {2011}, petsc_uses = {KSP} } @InProceedings{ knepley10b, author = {Matthew G. {Knepley}}, title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, note = {Fall Meeting Supplemental, Abstract IN44A-01}, year = {2010}, petsc_uses = {KSP} } @InProceedings{ mayknepleygurnis09, author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, note = {Fall Meeting Supplemental, Abstract P31A-A1241}, year = {2009}, petsc_uses = {KSP} } @InProceedings{ yuenknepleyerlebacherwright09, author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, title = {The Coming Role of {GPU} in Computational Geodynamics}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, note = {Fall Meeting Supplemental, Abstract DI22A-05}, year = {2009}, petsc_uses = {KSP} } @InProceedings{ aagaardknepleywilliams08, author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, volume = {89}, number = {53}, note = {Fall Meeting Supplemental, Abstract T41A-1925}, year = {2007}, petsc_uses = {KSP} } @InProceedings{ aagaardknepleywilliams07, author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, volume = {88}, number = {52}, note = {Fall Meeting Supplemental, Abstract T21B-1798}, year = {2007}, petsc_uses = {KSP} } @InProceedings{ aagaardknepleywilliams05, author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, title = {Development of software for studying earthquakes across multiple spatial and temporal scales by coupling quasi-static and dynamic simulations}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, volume = {86}, number = {52}, note = {Fall Meeting Supplemental, Abstract S53A-1072}, year = {2005}, petsc_uses = {KSP} } @InProceedings{ williamsgablehagermeadeaagaardknepley08, author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and Brad Aagaard and Matthew G. Knepley}, title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} Community Fault Model}, booktitle = {Proceedings of Geosciences '08}, address = {Wellington, NZ}, month = nov, year = {2008}, petsc_uses = {KSP} } @TechReport{ zhang07, title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for Tsunamis}, author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, type = {Preprint}, number = {ANL/MCS-P1459-0907}, institution = {ANL}, month = sep, year = {2007}, petsc_uses = {KSP} } @Article{ katz08b, author = {Richard F. Katz}, title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic focusing at mid-ocean ridges}, journal = {J. Petrology}, year = {2008}, volume = {49}, pages = {2099--2121}, doi = {10.1093/petrology/egn058}, petsc_uses = {KSP} } @Article{ hgrhkjvv2008, title = {On preconditioning for a parallel solution of the {R}ichards equation}, author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, journal = {Computers and Geosciences}, volume = {34}, pages = {1958--1963}, year = {2008}, petsc_uses = {KSP} } @Article{ maymoresi2008, title = {Preconditioned iterative methods for {Stokes} flow problems arising in computational geodynamics}, journal = {Physics of the Earth and Planetary Interiors}, volume = {171}, number = {1-4}, pages = {33--47}, year = {2008}, note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and Applications}, issn = {0031-9201}, doi = {10.1016/j.pepi.2008.07.036}, author = {Dave A. May and Louis Moresi}, keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, petsc_uses = {KSP} } @Article{ kausmuhlhausmay2010, title = {A stabilization algorithm for geodynamic numerical simulations with a free surface}, author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, journal = {Physics of the Earth and Planetary Interiors}, volume = {181}, number = {1}, pages = {12--20}, year = {2010}, petsc_uses = {KSP} } @Article{ duretzmaygeryatackley2011, title = {Discretization errors and free surface stabilization in the finite difference and marker-in-cell method for applied geodynamics: A numerical study}, author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, journal = {Geochemistry, Geophysics, Geosystems}, volume = {12}, number = {7}, year = {2011}, petsc_uses = {KSP} } @Article{ furuichimaytackley2011, title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a {Schur} complement approach with mixed precision arithmetic}, author = {Mikito Furuichi and Dave A May and Paul J Tackley}, journal = {Journal of Computational Physics}, volume = {230}, number = {24}, pages = {8835--8851}, year = {2011}, petsc_uses = {KSP} } @Article{ kellermaykaus2013, title = {Numerical modelling of magma dynamics coupled to tectonic deformation of lithosphere and crust}, author = {Tobias Keller and Dave A May and Boris JP Kaus}, journal = {Geophysical Journal International}, volume = {195}, number = {3}, pages = {1406--1442}, year = {2013}, petsc_uses = {KSP} } @Article{ schellartfreemanstegmanmoresimay2007, title = {Evolution and diversity of subduction zones controlled by slab width}, author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A May}, journal = {Nature}, volume = {446}, number = {7133}, pages = {308--311}, year = {2007}, petsc_uses = {KSP} } @Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, title = {A comparison of numerical surface topography calculations in geodynamic modelling: an evaluation of the sticky air method}, author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, journal = {Geophysical Journal International}, volume = {189}, number = {1}, pages = {38--54}, year = {2012}, petsc_uses = {KSP} } @Article{ stegmanfreemanschellartmoresimay2006, title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab rollback}, author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A May}, journal = {Geochemistry, Geophysics, Geosystems}, volume = {7}, number = {3}, year = {2006}, petsc_uses = {KSP} } @InProceedings{ may2014ptatin, title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, booktitle = {Proceedings of {SC14}: The {International Conference for High Performance Computing, Networking, Storage and Analysis}}, organization = {ACM}, pages = {274--284}, year = {2014}, doi = {10.1109/SC.2014.28}, petsc_uses = {KSP} } @Article{ maybrownpourhiet2015, title = {A scalable, matrix-free multigrid preconditioner for finite element discretizations of heterogeneous {Stokes} flow}, author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {290}, pages = {496--523}, year = {2015}, doi = {10.1016/j.cma.2015.03.014}, petsc_uses = {KSP} } @Article{ duretzmayyamato2016, title = {A free surface capturing discretization for the staggered grid finite difference scheme}, author = {Thibault Duretz and Dave A May and Philippe Yamato}, journal = {Geophysical Journal International}, volume = {204}, number = {3}, pages = {1518--1530}, year = {2016}, petsc_uses = {KSP} } @Article{ rhebergenwellskatzwathen2014, author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, journal = {SIAM J. Sci. Comput.}, volume = {36}, pages = {A1960--A1977}, year = {2014}, petsc_uses = {KSP} } @Article{ katz08a, author = {R.F. Katz and M.G. Worster}, title = {Simulation of directional solidification, thermochemical convection, and chimney formation in a {H}ele-{S}haw cell}, journal = {J. Comp. Phys.}, volume = {227}, pages = {9823-9840}, year = {2008}, doi = {10.1016/j.jcp.2008.06.039}, petsc_uses = {KSP} } @Article{ aabg2007, author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, title = {Full waveform inversion for seismic velocity and anelastic losses in heterogeneous structures}, journal = {Bulletin of Seismological Society of America}, year = {2007}, volume = {97}, pages = {1990--2008}, petsc_uses = {KSP} } @Article{ katz2006, author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, title = {The dynamics of melt and shear localization in partially molten aggregates}, journal = {Nature}, year = {2006}, volume = {442}, pages = {676--679}, month = aug, day = {10}, url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, petsc_uses = {KSP} } @InProceedings{ mqrs2003, author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, year = {2003}, title = {Parallel Preconditioning for Sedimentary Basin Simulations}, booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, Sozopol, Bulgaria, June 4-8, 2003}, petsc_uses = {KSP} } @InProceedings{ lichtner1, author = {Chuan Lu and Peter C. Lichtner}, year = {2005}, title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in Geologic Media}, booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, lab = {LANL}, petsc_uses = {KSP} } @Article{ hammondlichtnermills2014, title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative Example with {PFLOTRAN}}, author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, journal = {Water Resources Research}, volume = {50}, number = {1}, pages = {208--228}, doi = {10.1002/2012WR013483}, year = {2014}, petsc_uses = {KSP} } @Article{ smw2003, author = {R. Scheichl and R. Masson and J. Wendebourg}, title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, journal = {Computational Geosciences}, year = {2003}, volume = {7}, pages = {295--318}, url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, petsc_uses = {KSP} } @Article{ kees-miller-03, author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, journal = {Computational Geosciences}, year = {2003}, volume = {7}, pages = {91--114}, petsc_uses = {KSP} } @Article{ bk2003, author = {JN Buur and T Kuehnel}, title = {Improving depth imaging by automated model updating}, journal = {The Leading Edge}, year = {2003}, volume = {22}, pages = {310-318}, petsc_uses = {KSP} } @Article{ frederickbuffett2016, title = {Submarine groundwater discharge as a possible formation mechanism for permafrost-associated gas hydrate on the circum-Arctic continental shelf}, author = {Jennifer M. Frederick and Bruce A. Buffett}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {121}, number = {3}, pages = {1383--1404}, issn = {2169-9356}, doi = {10.1002/2015JB012627}, year = {2016}, petsc_uses = {KSP} } % LiteralHTML:
% LiteralHTML: % LiteralHTML:Simulation of the earth's mantle and crust is valuable to % LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a % LiteralHTML:variety of these simulations.

% LiteralHTML:
% LiteralHTML: @InProceedings{ appelbe1, author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, year = {2003}, title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and computational methodology}, page = {781}, booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference Proceedings}, publisher = {Springer-Verlag}, url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, petsc_uses = {KSP} } % LiteralHTML:
@InProceedings{ gd1, author = {Guillaume Dumont and Michel Kern}, title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, year = {1999}, booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific Computing}, petsc_uses = {KSP} } % LiteralHTML:
        % LiteralHTML:        

% LiteralHTML: % LiteralHTML: Figures from the work of Richard Katz @PhDThesis{ katzthesis, author = {R.F. Katz}, title = {The deep roots of volcanoes: models of magma dynamics with applications to subduction zones}, school = {Columbia University}, year = {2005}, url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, petsc_uses = {KSP} } @InCollection{ knepleykatzsmith06, author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL USA}, title = {Developing a Geodynamics Simulator with {PETSc}}, booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, series = {Lecture Notes in Computational Science and Engineering}, editor = {Bruaset, Are Magnus and Tveito, Aslak}, publisher = {Springer Berlin Heidelberg}, isbn = {978-3-540-31619-0}, keyword = {Mathematics and Statistics}, pages = {413-438}, volume = {51}, doi = {10.1007/3-540-31619-1_12}, year = {2006}, petsc_uses = {KSP} } @Article{ katz04, author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in the global mid-ocean ridge system}, journal = {Geophys.\ Res.\ Letts.}, year = {2004}, volume = {31}, pages = {L15605}, petsc_uses = {KSP} } @Article{ katz07, author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and Ethan Coon}, title = {Numerical simulation of geodynamic processes with the {Portable Extensible Toolkit for Scientific Computation}}, journal = {Phys. Earth Planet. In.}, volume = {163}, pages = {52--68}, year = {2007}, petsc_uses = {KSP} } @Article{ williams2006development, title = {{Development of a package for modeling stress in the lithosphere}}, author = {Williams, CA}, journal = {Eos Trans. AGU}, volume = {87}, pages = {36}, year = {2006}, petsc_uses = {KSP} } @Article{ goverswortel05, author = {R. Govers and M.J.R. Wortel}, title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, journal = {Earth and Planetary Science Letters}, volume = {236/1-2}, pages = {505-523}, year = {2005}, petsc_uses = {KSP} } @InProceedings{ snark2, author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, year = {2002}, title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, petsc_uses = {KSP} } @Article{ snark1, author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang Tan and Feng Wang}, title = {Snark - A Reusable Framwork for Geoscience Computational Models}, journal = {Submitted to Pure and Applied Geosciences}, petsc_uses = {KSP} } @InProceedings{ earthquake2003, author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and Tiankai Tu}, year = {2003}, title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, booktitle = {Proceedings of SC2003}, note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, petsc_uses = {KSP} } @InProceedings{ stefano12, author = {Michele De Stefano}, title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, booktitle = {PIERS Proceedings}, month = aug, address = {Moscow, RUSSIA}, pages = {491--495}, year = {2012}, petsc_uses = {KSP} } %http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= % LiteralHTML:
% LiteralHTML:

@Article{ khatiwala07, author = {Khatiwala, S.}, title = {A computational framework for simulation of biogeochemical tracers in the ocean}, journal = {Glob. Biogeochem. Cycles}, volume = {21}, doi = {10.1029/2007GB002923}, year = {2007}, url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} } @Article{ dks2004, author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, journal = {Ocean Modelling}, year = {2004}, volume = {6(2)}, pages = {125-150}, title = {A finite-element Ocean Model: Principles and Evaluation}, url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, petsc_uses = {KSP} } @Article{ danilov1, author = {S. Danilov and G. Kivman and J. Schroter}, year = {2004}, title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth {A}tlantic}, journal = {Ocean Modelling}, petsc_uses = {KSP} } @Article{ nerger1, author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, year = {2004}, title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to a Finite Element Model of the {N}orth {A}tlantic}, journal = {Journal of marine systems}, petsc_uses = {KSP} } @Conference{ rakowsky2003self, title = {{A self-adaptive finite element model of the atmosphere}}, author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, pages = {279}, isbn = {981238376X}, year = {2003}, organization = {World Scientific Pub Co}, petsc_uses = {KSP} } @Article{ lauter3, author = {M. Lauter}, year = {2004}, title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven AtmosphArenmodell}, journal = {Berichte zur Polar- und Meeresforschung}, petsc_uses = {KSP} } @Article{ lauter2, author = {M. Lauter and D. Handorf and K. Dethloff}, year = {2004}, title = {Unsteady analytical solutions of the spherical shallow water equations}, journal = {Journal of computational physics}, petsc_uses = {KSP} } @PhDThesis{ lauter1, author = {M. Lauter}, year = {2004}, title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven AtmosphArenmodell}, institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, petsc_uses = {KSP} } @Article{ frickenhaus1, author = {S. Frickenhaus and W. Hiller and M. Best}, year = {2005}, title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of parallel numerical atmosphere and ocean models}, journal = {Ocean Modelling}, volume = {10}, pages = {185--191}, petsc_uses = {KSP} } @Article{ 0266-5611-24-3-034015, author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform seismic inversion}, journal = {Inverse Problems}, volume = {24}, number = {3}, pages = {034015 (26pp)}, url = {http://stacks.iop.org/0266-5611/24/034015}, year = {2008}, abstract = {We present a nonlinear optimization method for large-scale 3D elastic full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear iterations with inner conjugate gradient linear iterations, globalized by an Armijo backtracking line search, solved on a sequence of finer grids and higher frequencies to remain in the vicinity of the global optimum, inexactly terminated to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total variation operator to capture sharp interfaces, finely discretized by finite elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, implemented in matrix-free fashion with adjoint-based computation of reduced gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime waveform storage, and partitioned spatially across processors to parallelize the solutions of the forward and adjoint wave equations and the evaluation of gradient-like information. Several numerical examples demonstrate the grid independence of linear and nonlinear iterations, the effectiveness of the preconditioner, the ability to solve inverse problems with up to 17 million inversion parameters on up to 2048 processors, the effectiveness of multiscale continuation in keeping iterates in the basin of attraction of the global minimum, and the ability to fit the observational data while reconstructing the model with reasonable resolution and capturing sharp interfaces.}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Environmental -- Subsurface Flow

% LiteralHTML: % LiteralHTML:
% LiteralHTML: % LiteralHTML:Modeling surface flow of water is valuable for both flood control and % LiteralHTML:agricultural and environmental reasons. For example, regenerating the % LiteralHTML:Florida Everglades requires extensive understanding of the surface water % LiteralHTML:characteristics over thousands of square miles. PETSc has been used % LiteralHTML:for a variety of these simulations.

% LiteralHTML:
% LiteralHTML: @Article{ mills2009modeling, title = {Modeling subsurface reactive flows using leadership-class computing}, author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and Mahinthakumar, G.K. and Smith, B.F.}, journal = {Journal of Physics: Conference Series}, volume = {180}, pages = {012062}, year = {2009}, publisher = {IOP Publishing}, petsc_uses = {KSP} } @Conference{ mills2007simulating, title = {{Simulating subsurface flow and transport on ultrascale computers using PFLOTRAN}}, author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, booktitle = {Journal of Physics: Conference Series}, volume = {78}, pages = {012051}, year = {2007}, organization = {IOP Publishing}, petsc_uses = {KSP} } @InProceedings{ mills2009, title = {Modeling subsurface reactive flows using leadership-class computing}, author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and Mahinthakmuar, G. and Smith, B.}, booktitle = {Journal of Physics: Conference Series}, volume = {180}, pages = {102062}, year = {2009}, organization = {IOP Publishing}, petsc_uses = {KSP} } @Article{ guo2013parallel, title = {A parallel, fully coupled, fully implicit solution to reactive transport in porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method }, journal = {Advances in Water Resources }, volume = {53}, number = {0}, pages = {101 - 108}, year = {2013}, note = {}, issn = {0309-1708}, doi = {10.1016/j.advwatres.2012.10.010}, author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block preconditioner}, petsc_uses = {KSP} } @Unpublished{ stomp, title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, url = {http://stomp.pnl.gov/}, petsc_uses = {KSP} } @InProceedings{ htfc2003, author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, title = {Methods and Experiences For Parallelizing Flood Models}, year = {2003}, booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th European PVM/MPI User's Group Meeting}, note = {Springer Lecture Notes in Computer Science, Volume 2840}, url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, petsc_uses = {KSP} } @InProceedings{ hulchy-tran-astalos-fmsip, author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and D.Froehlich}, title = {Flood Modeling System and Its Parallelization}, year = {2002}, booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical Engineering}, url = {http://portal.acm.org/citation.cfm?id=824476.825951}, petsc_uses = {KSP} } @InProceedings{ gy1, author = {J. P. Gwo and G. T. Yeh}, title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive Transport at Watershed Scale}, year = {2004}, booktitle = {The International Conference on Computational Methods}, url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, petsc_uses = {KSP} } @Conference{ cheng2009efficient, title = {{An efficient parallel method for large-scale groundwater flow equation based on PETSc}}, author = {Cheng, T. and Ji, X. and Wang, Q.}, booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth Conference on}, pages = {190--193}, organization = {IEEE}, petsc_uses = {KSP} } @Unpublished{ sfrsm, title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for its linear solves}, petsc_uses = {KSP} } % LiteralHTML:
@InProceedings{ bart_omar:sc05, author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, title = {Dynamic data driven inversion for terascale simulations: real-time indentification of airborne contaminants}, booktitle = {Proceedings of SC2005}, organization = {IEEE/ACM}, address = {Seattle, WA}, year = {2005}, month = nov, url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, lab = {SNL}, petsc_uses = {KSP} } @InProceedings{ anton-krassimir-lscc, author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution Simulations}, booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, volume = {2907}, year = {2003}, publisher = {Springer-Verlag}, url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, petsc_uses = {KSP} } @InProceedings{ aa2001, author = {Anton Antonov}, title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, year = {2001}, booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, Sozopol, Bulgaria}, note = {Springer Lecture Notes in Computer Science, Volume 2179}, url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, petsc_uses = {KSP} } % LiteralHTML:
@Article{ grassley-simmons-kercher-00, author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, year = {2000}, title = {Mineralogical heterogeneity in fractured, porous media and its representation in reactive transport models}, journal = {Applied Geochemistry}, volume = {17}, pages = {699--708}, lab = {LLNL} } @Article{ glassey-nitao-03, author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson and Carl I. Steefel and James R. Kercher}, year = {2003}, title = {The impact of climate change on vadose zone pore waters and its implication for long-term monitoring}, journal = {Computers and Geosciences}, volume = {29}, pages = {399-411}, lab = {LLNL}, petsc_uses = {KSP} } @Article{ steefel-depaolo-lichtner-05, author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, year = {2005}, title = {Reactive transport modeling: An essential tool and a new research approach for the Earth sciences}, journal = {Earth and Planetary Science Letters}, lab = {LLNL,LANL}, petsc_uses = {KSP} } % LiteralHTML:
% LiteralHTML:
% LiteralHTML:

% LiteralHTML: % LiteralHTML: Sample strong scaling for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) @InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing Strategies for Large-Scale Numerical Simulations}, author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody J. Permann and Andrew E. Slaughter and Richard C. Martineau}, booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for Large-Scale Systems (scalA)}, pages = {65-72}, doi = {10.1109/ScalA.2018.00012}, month = nov, year = {2018}, petsc_uses = {KSP} } @Article{ km2004, author = {A. Keese and H. G. Matthies}, journal = {Computers and Structures}, year = {2005}, volume = {83}, pages = {1033--1047}, title = {Hierarchical parallelisation for the solution of stochastic finite element equations}, url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, petsc_uses = {KSP} } @Unpublished{ hvl2002, title = {Numerical Modeling of {NAPL} Source Zone Treatment}, author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, year = {2002}, lab = {LANL}, petsc_uses = {KSP} } @PhDThesis{ hammond2003, author = {Glenn E. Hammond}, title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater Transport on Supercomputers}, school = {University of Illinois at Urbana-Champaign}, year = {2003}, url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, petsc_uses = {KSP} } @Unpublished{ uk, title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large Scale Environmental Flows and Transport Processes}, url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around buildings and in Green Bay. Used PETSc for its linear solvers}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ hammond2002, author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, year = {2002}, url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water Resources, Delft, The Netherlands.}, lab = {LANL}, petsc_uses = {KSP} } @TechReport{ steefel1, author = {C. I. Steefel}, title = {Software for modeling multicomponent, multidimensional reactive transport}, year = {2001}, institution = {Lawrence Livermore National Laboratory}, number = {UCRL-MA-143182}, lab = {LLNL}, petsc_uses = {KSP} } @Article{ steefel2, author = {C. I. Steefel and A. C. Lasaga}, title = {A coupled model for transport of multiple chemical-species and kinetic precipitation dissolution reactions with application to reactive flow in single-phase hydrothermal systems}, journal = {Americal Journal of Science}, year = {1994}, pages = {529-592}, volume = {294}, number = {5}, petsc_uses = {KSP} } @TechReport{ steefel3, author = {C. I. Steefel and S. B. Yabusaki}, title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: User's manual and programmer's guide}, year = {1996}, institution = {Pacific Northwest National Laboratory}, number = {PNNL-11166}, lab = {PNNL}, petsc_uses = {KSP} } @Article{ 2005hvl, author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based preconditioning to biogeochemical transport}, journal = {Advances in Water Resources}, year = {2005}, pages = {359--376}, volume = {28}, url = { http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, lab = {LANL}, petsc_uses = {KSP} } @Article{ wang-zabar-05, author = {J Wang and N Zabaras}, journal = {Int. J. Heat and Mass Transfer}, title = {A Markov random field model of contamination source identification in porous media flow}, year = {2005}, petsc_uses = {KSP} } @InBook{ kp1, author = {Jong G. Kim and Hyoung W. Park}, chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous Media}, url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, title = {Lecture Notes in Computer Science}, publisher = {Springer-Verlag}, volume = {3044}, year = {2004}, petsc_uses = {KSP} } @Article{ 2001agusm...h32a06k, author = {{Kim}, J.~G. and {Kim}, J.}, title = {Parallel Implementation of Finite Element Groundwater Flow Model}, journal = {AGU Spring Meeting Abstracts}, year = {2001}, pages = {32-+}, petsc_uses = {KSP} } @Article{ lzb2005, author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, journal = {Journal of Hydraulic Engineering}, year = {2005}, volume = {131}, number = {4}, pages = {247--258}, petsc_uses = {KSP} } @Article{ rao2005, author = {Prasada Rao}, title = {A parallel {RMA2} model for simulating large-scale free surface flows}, journal = {Environmental Modelling and Software}, year = {2005}, pages = {47--53}, petsc_uses = {KSP} } @InProceedings{ pr1, author = {Prasada Rao}, title = {An Efficient Scalable Finite Element Model for Simulating Large Scale Hydrodynamic Flows}, year = {2003}, booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics Conference}, url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, petsc_uses = {KSP} } @InProceedings{ lichtner2004, author = {Peter C. Lichtner and Andrew Wolfsberg}, title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand Challenge Supercomputing Problem}, year = {2004}, booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, lab = {LANL}, petsc_uses = {KSP} } % LiteralHTML:
@Article{ aba01:petsc-app, author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, journal = {Int. J. High Performance Computing Applications}, year = {2001}, volume = {15}, number = {1}, pages = {13--21}, petsc_uses = {KSP} } @PhDThesis{ tjb200, author = {Thomas James Byer}, title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface Facilities}, school = {Stanford}, year = {2000}, petsc_uses = {KSP} } @InProceedings{ puchyr2006, author = {Peter J. Puchyr}, title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a {Win32} Cluster}, booktitle = {Proceedings of the Canadian International Petroleum Conference}, note = {Paper number CIPC2006-207}, year = {2006}, petsc_uses = {KSP} } @InProceedings{ texas98, author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith and G. A. Pope}, title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir Simulation}, booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation Symposium}, note = {also available as Argonne preprint ANL/MCS-P743-1298}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, year = {1998}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

CFD

% LiteralHTML: @Article{ farrellmitchellscottwechsung2021, title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the stationary incompressible {Navier-Stokes} equations}, author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian Wechsung}, journal = {The SMAI journal of computational mathematics}, volume = {7}, pages = {75--96}, year = {2021}, petsc_uses = {KSP} } @Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott P MacLachlan and Ray S Tuminaro}, journal = {SIAM Journal on Scientific Computing}, number = {0}, pages = {S70--S91}, year = {2021}, petsc_uses = {KSP} } @Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible hyperelasticity}, author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo Oyar\'ua and Ricardo Ruiz-Baier}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {374}, pages = {113562}, issn = {0045-7825}, doi = {https://doi.org/10.1016/j.cma.2020.113562}, url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, year = {2021}, petsc_uses = {KSP} } @Article{ farrellmitchellwechsung2018, title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible {Navier-Stokes} equations at high {Reynolds} number}, author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, journal = {SIAM Journal on Scientific Computing}, volume = {41}, number = {5}, eprint = {1810.03315}, pages = {A3073-A3096}, year = {2019}, petsc_uses = {KSP} } @Article{ hevuikklaij2017, title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations discretized by a finite volume method}, author = {Xin He and Cornelis Vuik and Christiaan Klaij}, journal = {Journal of Numerical Mathematics}, volume = {25}, number = {2}, pages = {89--105}, year = {2017}, petsc_uses = {KSP} } @InProceedings{ zou2015newton, title = {Newton--Krylov methods in applications of two-phase flow problems with phase appearance/disappearance}, author = {Zou, L and Zhao, H and Zhang, H}, booktitle = {ANS 2015 Annual Meeting, June}, volume = {7}, number = {11}, year = {2015}, petsc_uses = {KSP} } @Article{ guermond2009nonlinear, title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a Fourier/finite element technique and an interior penalty method}, author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, journal = {Journal of computational physics}, volume = {228}, number = {8}, pages = {2739--2757}, year = {2009}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ erzincanlisahin2015, title = {The numerical simulation of the wing kinematics effects on near wake topology and aerodynamic performance in hovering {D}rosophila flight}, author = {Belkis Erzincanli and Mehmet Sahin}, journal = {Computers \& Fluids}, volume = {122}, pages = {90--110}, year = {2015}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ ekensahin2015, title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid structure interaction problems}, author = {Ali Eken and Mehmet Sahin}, journal = {International Journal for Numerical Methods in Fluids}, year = {2015}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @Article{ hwangsucai2015, title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method for transonic full potential equation}, author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, journal = {Computers \& Fluids}, volume = {110}, number = {30}, pages = {96--107}, year = {2015}, doi = {10.1016/j.compfluid.2014.04.005}, petsc_uses = {KSP} } @Article{ yanghwangcai2016, title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of {PDE}-Constrained Optimization Problems}, author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, journal = {SIAM Journal on Scientific Computing}, volume = {38}, number = {5}, pages = {A2756--A2778}, year = {2016}, petsc_uses = {KSP} } @Article{ khanaidun2011, author = {Irfan Khan and Cyrus K. Aidun}, title = {Direct numerical simulation of saturated deformable porous media using parallel hybrid Lattice-{B}oltzmann and finite element method}, journal = {Int. J. Numer. Meth. Eng.}, volume = {86}, pages = {1379--1395}, year = {2011}, petsc_uses = {KSP} } @Article{ khanaidun2014, author = {Irfan Khan and Cyrus K. Aidun}, title = {Modeling the deformation of saturate porous media using direct numerical simulation}, journal = {Int. J. Multiphase Flow}, doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, year = {2014}, petsc_uses = {KSP} } @Article{ mofidi2014simulations, author = {A. Mofidi and P. M. Carrica}, title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder and Propeller}, journal = {Computers and Fluids}, pages = {191--203}, year = {2014}, petsc_uses = {KSP} } @Article{ paik2014fluidstructure, author = {K. Paik and P. M. Carrica}, title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free Surface in a Rolling Tank}, journal = {Ocean Engineering}, pages = {201--212}, year = {2014}, petsc_uses = {KSP} } @Article{ castro2013bubble, author = {A. M. Castro and P. M. Carrica}, title = {Bubble size distribution prediction for large-scale ship flows: {Model} evaluation and numerical issues}, journal = {International Journal of Multiphase Flow 57}, pages = {131--150}, year = {2013}, petsc_uses = {KSP} } @Article{ carrica2013turn, author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with Dynamic Overset Grids}, journal = {Journal of Marine Science and Technology}, pages = {166--181}, year = {2013}, petsc_uses = {KSP} } @Article{ castro2013eulerian, author = {A. M. Castro and P. M. Carrica}, title = {Eulerian polydispersed modeling of bubbly flows around ships with application to {Athena} {R}/V,}, journal = {International Shipbuilding Progress}, pages = {403--433}, year = {2013}, petsc_uses = {KSP} } @Article{ chase2013overset, author = {N. Chase and T. Michael and P. M. Carrica}, title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and {Maneuvering} {Conditions}}, journal = {International Shipbuilding Progress}, pages = {171--205}, year = {2013}, petsc_uses = {KSP} } @Article{ sadathosseini2013wu, author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. Stern}, title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and Free Surge Conditions in Short and Long Head Waves}, journal = {Ocean Engineering}, volume = {59}, pages = {240--273}, year = {2013}, petsc_uses = {KSP} } @Article{ chase2013cfd, author = {N. Chase and P. M. Carrica}, title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a Submarine}, journal = {Ocean Engineering}, pages = {68--80}, year = {2013}, petsc_uses = {KSP} } @Article{ carrica2012cfd, author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation of Moving Rudders and Rotating Propellers}, journal = {Computers and Fluids 53}, pages = {117--132}, year = {2012}, petsc_uses = {KSP} } @Article{ sakamoto2012urans, author = {N. Sakamoto and P. M. Carrica and F. Stern}, title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, publisher = {Journal of Marine Science and Technology}, pages = {422--445}, year = {2012}, petsc_uses = {KSP} } @Article{ sakamoto2012uransb, author = {N. Sakamoto and P. M. Carrica and F. Stern}, title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: Analysis and Validation of Local Flow Characteristics}, journal = {Journal of Marine Science and Technology}, pages = {446--468}, year = {2012}, petsc_uses = {KSP} } @Article{ li2012dynamic, author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, journal = {Renewable Energy}, pages = {285--298}, year = {2012}, petsc_uses = {KSP} } @Article{ huang2012a, author = {J. Huang and P. M. Carrica and F. Stern}, title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, journal = {International Journal for Numerical Methods in Fluids}, pages = {160--180}, year = {2012}, petsc_uses = {KSP} } @Article{ huang2012b, author = {J. Huang and P. M. Carrica and F. Stern}, title = {A geometry-based level set method for curvilinear overset grids with application to ship hydrodynamics}, journal = {International Journal for Numerical Methods in Fluids}, pages = {494--521}, year = {2012}, petsc_uses = {KSP} } @Article{ carrica2011computations, author = {P. M. Carrica and H. Fu and F. Stern}, title = {Computations of self-propulsion free to sink and trim and of motions in head waves of the {KRISO} {Container} {Ship} ({KCS}) model}, journal = {Applied Ocean Research}, pages = {309--320}, year = {2011}, petsc_uses = {KSP} } @Article{ bhushan2011scalability, author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, title = {Scalability and Validation Study for Large Scale Surface Combatant Computations Using {CFDShip}-Iowa}, journal = {International Journal of High Performance Computing Applications}, pages = {466--487}, year = {2011}, petsc_uses = {KSP} } @Article{ castro2011full, author = {A. M. Castro and P. M. Carrica and F. Stern}, title = {Full scale self-propulsion computations using discretized propeller for the {KRISO} container ship {KCS}}, journal = {Computers and Fluids}, pages = {35--47}, year = {2011}, petsc_uses = {KSP} } @Article{ kandasamy2011multifidelity, author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran for Low Wake}, journal = {Journal of Marine Science and Technology}, pages = {143--156}, year = {2011}, petsc_uses = {KSP} } @Article{ kandasamy2011cfd, author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, journal = {Journal of Marine Science and Technology}, pages = {157--167}, year = {2011}, petsc_uses = {KSP} } @Article{ sadathosseini2011cfd, author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto and S. Yamamura and A. Mastuda}, title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, Periodic Motion and Broaching}, journal = {Ocean Engineering}, pages = {88--110}, year = {2011}, petsc_uses = {KSP} } @Article{ mosaviraad2010development, author = {M. Mosaviraad and P. M. Carrica and F. Stern}, title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} with Comparison to Regular Wave and Transient Wave Group Procedures Using {URANS}}, journal = {Ocean Engineering}, pages = {653--666}, year = {2010}, petsc_uses = {KSP} } @Article{ carrica2010largescale, author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. Stern}, title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and Heave Problems for a Surface Combatant}, journal = {Computers and Fluids}, pages = {1095--1111}, year = {2010}, petsc_uses = {KSP} } @Article{ carrica2010selfpropulsion, author = {P. M. Carrica and A. M. Castro and F. Stern}, title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller with Dynamic Overset Grids}, journal = {Journal of Marine Science and Technology}, pages = {316--330}, year = {2010}, petsc_uses = {KSP} } @Article{ ismail2010evaluation, author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, journal = {International Journal of Numerical Methods in Fluids}, pages = {850--886}, year = {2010}, petsc_uses = {KSP} } @Article{ kandasamy2010integral, author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, journal = {Journal of Fluids Engineering}, pages = {101103}, year = {2010}, petsc_uses = {KSP} } @Article{ kirk:2014de, author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) stabilized finite element flow solver}}, journal = {Computers {\&} Fluids}, year = {2014}, volume = {92}, number = {0}, pages = {281--292}, month = mar, petsc_uses = {KSP} } @Article{ carracciuolo20111382, title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows in high performance computing environment}, journal = {Journal of Non-Newtonian Fluid Mechanics }, volume = {166}, number = {23--24}, pages = {1382--1395}, year = {2011}, issn = {0377-0257}, doi = {10.1016/j.jnnfm.2011.08.014}, author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. Maffettone and A. Murli}, keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element method, High performance computing}, petsc_uses = {KSP} } @Article{ bungartzgatzhammerliebmehlneckel11, author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, Miriam and Neckel, Tobias}, title = {Towards multi-phase flow simulations in the PDE framework Peano}, journal = {Computational Mechanics}, volume = {48}, number = {3}, pages = {365-376}, year = {2011}, issn = {0178-7675}, doi = {10.1007/s00466-011-0626-1}, publisher = {Springer-Verlag}, keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; Thermohydraulics; Two-phase flow}, language = {English}, petsc_uses = {KSP} } @Article{ bpr:cfl, author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler Equations}}, journal = {International Journal for Numerical Methods in Fluids}, year = {2009}, volume = {59}, number = {1}, pages = {1--18}, doi = {10.1002/fld.1798}, petsc_uses = {KSP} } @InBook{ bonfiglioli_campobasso_carpentieri_2010, author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently preconditioned newton-krylov solver}, publisher = {Curran Associates}, year = {2010}, url = {http://www.proceedings.com/05932.html}, petsc_uses = {KSP} } @Article{ bonfiglioli_rans_2005, author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, Bernardo}, title = {RANS simulations of a junction flow}, journal = {International Journal of Computational Fluid Dynamics}, volume = {19}, number = {2}, pages = {179-189}, year = {2005}, doi = {10.1080/10618560410001729126}, petsc_uses = {KSP} } @InCollection{ bonfiglioli__carpentieri_rans_2008, author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza Italy}, title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS Equations Using Fluctuation Splitting Schemes}, booktitle = {Numerical Mathematics and Advanced Applications}, editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, publisher = {Springer Berlin Heidelberg}, isbn = {978-3-540-69777-0}, pages = {151-158}, doi = {10.1007/978-3-540-69777-0_17}, year = {2008}, petsc_uses = {KSP} } @InCollection{ bonfiglioli__carpentieri_ens_2007, author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, Italy}, title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} Problems on Unstructured Grids}, booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, series = {Lecture Notes in Computer Science}, editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, publisher = {Springer Berlin / Heidelberg}, isbn = {978-3-540-75754-2}, pages = {676-685}, volume = {4699}, doi = {10.1007/978-3-540-75755-9_83}, year = {2007}, petsc_uses = {KSP} } @Article{ terrelscottknepleykirby08, author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, title = {Automated {FEM} Discretizations for the {Stokes} Equation}, journal = {BIT}, volume = {48}, number = {2}, year = {2008}, petsc_uses = {KSP} } @Article{ martamadermartinsweidealonso07, author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. J. Alonso}, title = {A methodology for the development of discrete adjoint solvers using automatic differentiation tools}, journal = {Computational Fluid Dyanmics}, volume = {21}, pages = {307--327}, year = {2007}, petsc_uses = {KSP} } @TechReport{ avb2008, author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface Waves}, year = {2008}, institution = {University of Twente, the Netherlands}, url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, petsc_uses = {KSP} } @InProceedings{ bdsm2005, author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, year = {2005}, url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, petsc_uses = {KSP} } @InProceedings{ ms2006, author = {S. Muller and Y. Stiriba}, title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR STEADY COMPRESSIBLE FLOWS}, booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, year = {2006}, url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, petsc_uses = {KSP} } @Article{ araujoteixeiracunhagroth08, author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, title = {Parallel three-dimensional simulation of the injection molding process}, journal = {International Journal for Numerical Methods in Fluids}, year = {2008}, url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, petsc_uses = {KSP} } @PhDThesis{ a2008, author = {A. Cubero}, title = {a parallel coupled algorithm for collocated grids and its application to Large Eddy Simulation of a turbulent wake}, school = {University of Zaragoza (Spain)}, year = {2008}, petsc_uses = {KSP} } @Article{ afa2007, author = {A. Cubero and N. Fueyo}, title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, journal = {Numerical Heat Transfer, part B-Fundamentals}, volume = {56}, number = {6}, pages = {507--529}, year = {2007}, url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, petsc_uses = {KSP} } @TechReport{ af2007, title = {Preconditioning based on a partially implicit implementation of Momentum Interpolation for coupled solvers}, institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, year = {2007}, author = {A. Cubero and N. Fueyo}, petsc_uses = {KSP} } @InCollection{ dwight2004, author = {Richard Dwight}, title = {Robust Mesh Deformation using the Linear Elasticity Equations}, booktitle = {Computational Fluid Dynamics 2006}, editor = {H. Deconinck and E. Dick}, publisher = {Springer}, year = {2006}, url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, petsc_uses = {KSP} } @InProceedings{ dwight2006, author = {Richard Dwight and Joel Brezillon}, title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based Optimization}, booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. AIAA-2006-0690}, year = {2006}, url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, petsc_uses = {KSP} } @PhDThesis{ dwight2006a, author = {Richard Dwight}, title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit and Adjoint Methods on Unstructured Grids}, school = {School of Mathematics, University of Manchester}, year = {2006}, url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, petsc_uses = {KSP} } @InProceedings{ lhdfrh, author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and W. Hiller}, title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere March, 10-14, 2003, Munich University of Technology, German}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ brios-ying-2002, author = {George Biros and Lexing Ying and Denis Zorin}, title = {The Embedded Boundary Integral Method (EBI) for the Incompressible {Navier-Stokes} equations}, booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, year = {2002}, petsc_uses = {KSP} } @InProceedings{ mohsen-straatman-ins, author = {S.A. Mohsen Karimian and Anthony G. Straatman}, title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible {Navier-Stokes} equation on a cluster of distributed-memory computers}, booktitle = {Proceedings of the 19th International Symposium on High Performance Computing Systems and Applications}, pages = {11--16}, year = {2005}, url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, petsc_uses = {KSP} } @TechReport{ bonglioli-icnmfd98, title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, institution = {Universita della Basilicata via della Tecnica 3}, year = {1996}, author = {A. Bonglioli}, url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, petsc_uses = {KSP} } @Article{ deng-piquet-ctf, author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, title = {A new fully coupled method for computing turbulent flows}, journal = {Computers and Fluids}, volume = {30}, pages = {445--472}, year = {2001}, petsc_uses = {KSP} } @InProceedings{ knepleysarinsameh99b, title = {Multilevel Preconditioning for Parallel {CFD}}, author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix Problems In Industrial Applications}, address = {Minneapolis, MN}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ garbey1, author = {M. Garbey and B. Hadri and W. Shyy.}, title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer Problems on the Grid}, booktitle = {Aerospace Sciences Meeting and Exhibit}, note = {Paper No. 2005-1386}, year = {2005}, petsc_uses = {KSP} } @Article{ carrica2007unsteady, title = {An unsteady single-phase level set method for viscous free surface flows}, author = {Carrica, PM and Wilson, RV and Stern, F.}, journal = {International Journal for Numerical Methods in Fluids}, volume = {53}, number = {2}, pages = {229--256}, year = {2007}, publisher = {Chichester; New York: Wiley, c1981-}, petsc_uses = {KSP} } @Article{ pctw2004, author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of Spillways}, journal = {Journal of Hydraulic Research}, note = {accepted for publication}, year = {2004}, petsc_uses = {KSP} } @Article{ wcs2004, author = {R. V. Wilson and P. M. Carrica and F. Stern}, title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface Combatant}, journal = {Computers and Fluids}, note = {in press}, year = {2004}, petsc_uses = {KSP} } @Article{ cws2005, author = {P. M. Carrica and R. V. Wilson and F. Stern}, title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, journal = {Computers and Fluids}, note = {accepted for publication}, year = {2005}, petsc_uses = {KSP} } @Article{ chndss2010, author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. Stern}, title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and Heave Problems for a Surface Combatant}, journal = {Computers and Fluids}, year = {2010}, volume = {39}, number = {7}, pages = {1095--1111}, petsc_uses = {KSP} } @InProceedings{ chnkss2008, author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. Stern}, title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear Grids}, booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, year = {2008}, petsc_uses = {KSP} } @MastersThesis{ mtj, author = {M. T. Jozkowski}, title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows About Submerged Bodies}, school = {The Pennsylvania State University}, year = {2005}, petsc_uses = {KSP} } @Article{ pp, author = {E. G. Paterson and L. J. Peltier}, title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and Wakes}, journal = {ASME Journal of Fluids Engineering}, note = {In press}, year = {2005}, petsc_uses = {KSP} } @Article{ eps, author = {B. A. Edge and E. G. Paterson and G. Settles}, title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, journal = {ASME Journal of Fluids Engineering}, note = {In press}, year = {2005}, petsc_uses = {KSP} } @InProceedings{ rp, author = {B. Racine and E. G. Paterson}, title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines Using Unsteady {RANS} {CFD}}, booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, year = {2005}, petsc_uses = {KSP} } @InProceedings{ etpp, author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids and DES}, booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ pp8, author = {E. G. Paterson and L. J. Peltier}, title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset refinement grids and detached-eddy simulation}, booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ mzwp, author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, booktitle = {25th Symposium on Naval Hydrodynamics}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ ppph, author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, booktitle = {25th Symposium on Naval Hydrodynamics}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ ppd, author = {E. G. Paterson and L. J. Peltier}, title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ bp, author = {W. J. Baker and E. G. and Paterson}, title = {Simulation of Steady Circulation Control for the General Aviation Circulation Control Wing}, booktitle = {NASA/ONR Workshop on Circulation Control}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ pb, author = {E. G. Paterson and W. J. Baker}, title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, booktitle = {NASA/ONR Workshop on Circulation Control}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ pb3, author = {E. G. Paterson and W. J. Baker}, title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control Surfaces}, booktitle = {42nd AIAA Aerospace Sciences Meeting}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ gid1, author = {G. Frank and J. D'Elia}, title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, year = {2004}, booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, petsc_uses = {KSP} } @InBook{ b1, author = {A.Bonfiglioli}, chapter = {On the use of the PETSc library for unstructured {CFD} applications}, year = {2001}, title = {Science and Supercomputing at CINECA}, pages = {397--400}, petsc_uses = {KSP} } @InProceedings{ b2004, author = {L. A. Barba}, title = {Computing high-Reynolds number vortical flows: a highly accurate method with a fully meshless formulation}, year = {2004}, booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, note = {Submitted}, petsc_uses = {KSP} } @InProceedings{ bl2004, author = {L. A. Barba and A. Leonard}, title = {Computation of Viscous Vortices with Fully Meshless Method}, year = {2004}, booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, note = {Submitted}, petsc_uses = {KSP} } @Article{ vws1, author = {B. G. M. Van Wachem and J. C. Schouten}, title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise Velocity}, institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The Netherlands}, journal = {AIChE}, volumne = {48}, number = {12}, month = dec, year = {2002}, petsc_uses = {KSP} } @TechReport{ lbam1, author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, title = {Precondizionatori paralleli per la fluidodinamica computazionale}, institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico di Bari Italy}, year = {2002}, number = {25/02}, petsc_uses = {KSP} } @Article{ kees_miller_02, author = {C. E. Kees and C. T. Miller}, title = {Higher Order Time Integration Methods for Two-Phase Flow}, journal = {Advances in Water Resources}, year = {2002}, volume = {25}, number = {2}, pages = {159-177.}, petsc_uses = {KSP} } @InProceedings{ lepotmeersessers2001, author = {I. Lepot and F. Meers and J.A. Essers}, title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D Unstructured Meshes}, year = {2001}, booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, url = {http://www.ulg.ac.be/aerodyn}, petsc_uses = {KSP} } @InProceedings{ knepley98, author = {Matthew Knepley and Denis Vanderstraeten}, title = {Parallel Building Blocks for Finite Element Simulations: Application to Solid-Liquid Mixture Flows}, booktitle = {Proceedings of Parallel CFD'97}, publisher = {Elsevier}, pages = {281--287}, year = {1998}, petsc_uses = {KSP} } @InProceedings{ pcfd97, author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, publisher = {Elsevier}, year = {1998}, booktitle = {Proceedings of Parallel CFD'97}, pages = {333-344}, petsc_uses = {KSP} } @InProceedings{ knepleysamehsari98, author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, title = {Parallel Simulation of Particulate Flows}, booktitle = {Solving Irregularly Structured Problems in Parallel}, editors = {A. Ferreira et al}, year = {1998}, series = {Lecture Notes in Computer Science}, volume = {1457}, pages = {226--237}, petsc_uses = {KSP} } @Article{ gkmt98, author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel Implicit {CFD}}, journal = {Int. J. High Performance Computing Applications}, year = {2000}, volume = {14}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, pages = {102-136}, petsc_uses = {KSP} } @InProceedings{ agkks-sc99, author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, editor = {}, publisher = {}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, year = {1999}, note = {Winner of Gordon Bell Special Prize at SC 99}, petsc_uses = {KSP} } @Article{ gkks01, author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {High Performance Parallel Implicit {CFD}}, journal = {Journal of Parallel Computing}, year = {2001}, volume = {27}, pages = {337-362}, url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, petsc_uses = {KSP} } @Article{ cristea-sofonea-02, author = {Artur Cristea and Victor Sofonea}, title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical Sciences, Information Sciences}, volume = {3}, number = {3}, year = {2002}, petsc_uses = {KSP} } @Article{ cristea2, author = {Artur Cristea and Victor Sofonea}, title = {Two component lattice Boltzmann model with flux limiter techniques}, journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical Sciences, Information Sciences}, volume = {4}, number = {1}, year = {2003}, pages = {59--64}, petsc_uses = {KSP} } @Article{ cristea1, author = {Artur Cristea and Victor Sofonea}, title = {Two component lattice Boltzmann model with flux limiters}, journal = {Central European Journal of Physics}, volume = {2}, number = {2}, year = {2004}, pages = {382--396}, petsc_uses = {KSP} } @Article{ sofnea-lamura1, author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor systems}, journal = {Physical Review E}, volume = {70}, number = {4}, year = {2004}, pages = {046702-1 / 046702-9}, petsc_uses = {KSP} } @InProceedings{ gkks01b, author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid Mechanics}, editor = {}, location = {Cambridge, MA}, year = {2001}, month = jun, url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, petsc_uses = {KSP} } @InProceedings{ gkks00, author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} Code}, booktitle = {Proceedings of the 7th International Conference on High Performance Computing (HiPC '2000)}, editor = {}, location = {Bangalore, India}, year = {2000}, pages = {395--404}, url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, petsc_uses = {KSP} } @InProceedings{ gkks-sc00, author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, booktitle = {Proceedings of SC2000}, editor = {}, publisher = {IEEE Computer Society}, year = {2000}, url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, petsc_uses = {KSP} } @InProceedings{ knepleysamehsarin99, author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, title = {Design of Large Scale Parallel Simulations}, booktitle = {Proceedings of Parallel CFD'99}, editors = {A. {Ecer et al.}}, publisher = {Elsevier}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ gkks-pcfd99, author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, booktitle = {Proceedings of Parallel CFD'99}, editors = {A. {Ecer et al.}}, publisher = {Elsevier}, url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ kks97, author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {On the Interaction of Architecture and Algorithm in the Domain-Based Parallelization of an Unstructured Grid Incompressible Flow Code}, booktitle = {Proceedings of the 10th International Conference on Domain Decomposition Methods}, editor = {J. Mandel et al.}, pages = {311--319}, publisher = {Wiley}, note = {}, year = {1997}, petsc_uses = {KSP} } @InProceedings{ kks99, author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and Incompressible Flows on Unstructured Grids}, booktitle = {Proceedings of the 11th International Conference on Domain Decomposition Methods}, editors = {C.-H. {Lai et al.}}, publisher = {Domain Decomposition Press, Bergen}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, year = {1999}, petsc_uses = {KSP} } @InCollection{ kks97_cfd, author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, title = {Perspectives for {CFD} on Petaflops Systems}, booktitle = {CFD Review 1998}, editor = {M. Hafez and K. Oshima}, publisher = {World Scientific, Singapore}, pages = {1079--1096}, note = {}, year = {1998}, petsc_uses = {KSP} } @Article{ hm99, author = {P. D. Hovland and L. C. McInnes}, title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and {PETSc}}, year = {2000}, journal = {Parallel Computing}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, petsc_uses = {KSP} } @InProceedings{ cruzbarbaknepley08, author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, title = {Fast Multipole Method for particle interactions: an open source parallel library component}, booktitle = {Proceedings of ParCFD2008}, year = {2008}, editor = {Tromeur-Dervout et. al.}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ hwangcai05, author = {F.-N. Hwang and X.-C. Cai}, title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm for incompressible {Navier-Stokes} equations}, journal = {J. Comput. Phys.}, volume = {204}, year = {2005}, pages = {666--691}, petsc_uses = {KSP} } @Article{ barbaleonard07, author = {Lorena A Barba and Anthony Leonard}, title = {Emergence and evolution of tripole vortices from net-circulation initial conditions}, journal = {Phys. Fluids}, volume = {19}, pages = {017101}, year = {2007}, doi = {10.1063/1.2409734}, petsc_uses = {KSP} } @Article{ barba07, author = {Lorena A Barba}, title = {Non-shielded multipolar vortices at high Reynolds number}, journal = {Phys. Rev. E}, volume = {73}, pages = {065303}, year = {2006}, doi = {10.1103/PhysRevE.73.065303}, petsc_uses = {KSP} } @Article{ schofield2010multi, title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and Lowrie, R.B. and Swartz, B.K.}, journal = {International Journal for Numerical Methods in Fluids}, volume = {63}, number = {8}, pages = {931--952}, year = {2010}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Wave propagation and the Helmholtz equation

% LiteralHTML: % LiteralHTML: article{DeGersem99, % LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, % LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, % LiteralHTML: } @Article{ nagler2014, title = {Sound transmission through a poroelastic layered panel}, author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, journal = {Computational Mechanics}, volume = {53}, number = {4}, pages = {549--560}, issn = {1432-0924}, doi = {10.1007/s00466-013-0916-x}, year = {2014}, petsc_uses = {KSP} } @Article{ sheikh2013, author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel deflation}, journal = {Numerical Linear Algebra with Applications}, volume = {20}, number = {4}, issn = {1099-1506}, doi = {10.1002/nla.1882}, pages = {645--662}, keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier analysis}, year = {2013}, petsc_uses = {KSP} } @InProceedings{ silence, author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. Fuenmayor}, title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: Application to the study of acoustic behaviour of silencers}, year = {2004}, booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering (ECCOMAS)}, petsc_uses = {KSP} } @Article{ degersem99, author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, journal = {COMPEL}, year = {1999}, volume = {18}, number = {3}, pages = {298--310}, bibdate = {}, petsc_uses = {KSP} } @InProceedings{ widlund-wave-98, author = {Olof B. Widlund}, title = {Schwarz Methods for {H}elmholtz's Equation}, booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, editor = {John A. DeSanto}, year = {1998}, publisher = {SIAM}, pages = {620--622}, address = {Philadelphia}, note = {Proceedings of the Fourth International Conference on Mathematical and Numerical Aspects of Wave Propagation, Golden, Colorado, June 1--5}, petsc_uses = {KSP} } @InProceedings{ toselli-wave-98, author = {Andrea Toselli}, title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, editor = {John A. DeSanto}, year = {1998}, publisher = {SIAM}, address = {Philadelphia}, pages = {540--542}, note = {Proceedings of the Fourth International Conference on Mathematical and Numerical Aspects of Wave Propagation, Golden, Colorado, June 1--5}, petsc_uses = {KSP} } @InProceedings{ mcinnes-wave-98, author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, editor = {John A. DeSanto}, year = {1998}, publisher = {SIAM}, address = {Philadelphia}, pages = {623--625}, note = {Proceedings of the Fourth International Conference on Mathematical and Numerical Aspects of Wave Propagation, Golden, Colorado, June 1--5}, petsc_uses = {KSP} } @InProceedings{ mska98, author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the Parallel Computation of {H}elmholtz Problems}, booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, editor = {J. Mandel et al.}, publisher = {AMS}, pages = {349--357}, year = {1998}, petsc_uses = {KSP} } @InProceedings{ ccew98, author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, editor = {J. Mandel et al.}, publisher = {AMS}, pages = {437-445}, year = {1998}, petsc_uses = {KSP} } @InProceedings{ ra98a, author = {R. Susan-Resiga and H. M. Atassi}, title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic Problems}, booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, publisher = {AIAA}, pages = {86-96}, note = {AIAA paper 98-2218}, year = {1998}, petsc_uses = {KSP} } @InProceedings{ ar98c, author = {H. M. Atassi and R. Susan-Resiga}, title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: General Formulation}, booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, publisher = {ASME}, note = {NCA-25}, pages = {375-379}, year = {1998}, petsc_uses = {KSP} } @InProceedings{ ra98b, author = {R. Susan-Resiga and H. M. Atassi}, title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: Numerical Implementation and Applications}, booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, publisher = {ASME}, note = {NCA-25}, pages = {381 -388}, year = {1998}, petsc_uses = {KSP} } @InProceedings{ cai-dd10-98, author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. Widlund}, title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, booktitle = {Domain Decomposition Methods 10}, editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, series = {Contemporary Mathematics}, volume = {218}, publisher = {American Mathematical Society}, address = {Providence, Rhode Island}, year = {1998}, pages = {437--445}, petsc_uses = {KSP} } @InProceedings{ alghamdi2011petclaw, title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, booktitle = {Proceedings of SpringSim 2011}, publisher = {ACM}, author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and Kyle T. Mandli and Lisandro Dalcin}, year = {2011}, petsc_uses = {KSP} } @Article{ pyclaw2012, author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew Emmett}, title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, journal = {SIAM Journal on Scientific Computing}, volume = {34}, number = {4}, pages = {C210--C231}, note = {\url{http://arxiv.org/abs/1111.6583}}, year = {2012}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Optimization

% LiteralHTML: @Article{ sojkahorakhaplacermak2018, title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain decomposition method}, author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, journal = {Applied Mathematics and Computation}, volume = {319}, pages = {586--597}, year = {2018}, petsc_uses = {KSP} } @Article{ chencai2014, title = {A parallel two-level domain decomposition based one-shot method for shape optimization problems}, author = {Rongliang Chen and Xiao‐Chuan Cai}, journal = {International Journal for Numerical Methods in Engineering}, volume = {99}, number = {13}, year = {2014}, doi = {10.1002/nme.4711}, petsc_uses = {KSP} } @PhDThesis{ prudencio2005, author = {Ernesto Prudencio}, title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software for Optimization Problems Constrained by Partial Differential Equations}, school = {University of Colorado, Boulder}, year = {2005}, petsc_uses = {KSP} } @Article{ prudenciocai2007, title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing for {PDE}-constrained optimization}, author = {Ernesto Prudencio and X. C. Cai}, journal = {SIAM J. Sci. Comp.}, volume = {29}, number = {3}, pages = {964--985}, year = {2007}, petsc_uses = {KSP} } @Article{ prudenciobyrdcai2006, author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for {PDE}-constrained Optimization Problems}, journal = {SIAM J. Sci. Comp.}, volume = {27}, pages = {1305--1328}, year = {2006}, petsc_uses = {KSP} } @InProceedings{ prudenciobyrdcai2004, title = {Domain decomposition methods for {PDE}-constrained optimization problems}, author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, booktitle = {VECPAR 2004}, editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, publisher = {Springer}, pages = {569--582}, year = {2004}, petsc_uses = {KSP} } @Article{ belhamadia-fortin-pcp, author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, journal = {Journal of Computational Physics}, volume = {201}, pages = {753-770}, year = {2004}, url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, petsc_uses = {KSP} } @Article{ biros00, author = {George Biros and Omar Ghattas}, title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, journal = {SIAG-Opt Views and News}, volume = {11}, number = {2}, year = {2000}, month = aug, url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, petsc_uses = {KSP} } @Article{ bmm01, author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, journal = {ACM Transactions on Mathematical Software}, title = {A case study in the performance and scalability of optimization algorithms}, year = {2001}, volume = {27}, number = {3}, pages = {361--376}, petsc_uses = {KSP} } @InProceedings{ oghattas1999, author = {George Biros and Omar Ghattas}, title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous incompressible flows}, booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ hkms00, title = {Using Automatic Differentiation for Second-order Matrix-free Methods in PDE-constrained Optimization}, author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent Hasco\"{e}t and Uwe Naumann}, publisher = {Springer}, year = {2002}, petsc_uses = {KSP} } % old version: replace with biros2005pln1 @TechReport{ bg011, author = {George Biros and Omar Ghattas}, title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. Part I: The Krylov-Schur Solver}, institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, year = {2001}, url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, petsc_uses = {KSP} } % old version: replace with biros2005pln2 @TechReport{ bg012, author = {George Biros and Omar Ghattas}, title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to Optimal Control of Steady Viscous Flows}, institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, year = {2001}, url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Fast Algorithms

% LiteralHTML: @InProceedings{ ly2003, author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, title = {A New Parallel Kernel-independent Fast Multipole Method}, booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, year = {2003}, note = {Winner of the Best Student Paper at SC2003}, petsc_uses = {KSP} } @Article{ yokotabarbaknepley10, author = {Rio Yokota and L A Barba and Matthew G Knepley}, title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {199}, number = {25-28}, pages = {1793--1804}, url = {http://arxiv.org/abs/0909.5413v1}, note = {\url{http://arxiv.org/abs/0909.5413v1}}, year = {2010}, petsc_uses = {KSP} } @Article{ cruzknepleybarba10, author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, journal = {International Journal of Numerical Methods in Engineering}, volume = {85}, number = {4}, pages = {403--428}, url = {http://arxiv.org/abs/0905.2637}, note = {\url{http://arxiv.org/abs/0905.2637}}, year = {2010}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Other Application Areas

% LiteralHTML: @Article{ buchanpainumplebysmedleystevenson2012, title = {A sub-grid scale finite element agglomeration multigrid method with application to the Boltzmann transport equation}, author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, journal = {International Journal for Numerical Methods in Engineering}, volume = {92}, number = {3}, pages = {318--342}, year = {2012}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @Article{ magoulesahamedsuzuki2015, title = {Green computing on graphics processing units}, author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, journal = {Concurrency and Computation: Practice and Experience}, year = {2015}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @InProceedings{ yanrhodes11, author = {Yan, Baoqiang and Rhodes, Philip J.}, title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, series = {ICPP '11}, pages = {355--364}, year = {2011}, isbn = {978-0-7695-4510-3}, numpages = {10}, doi = {10.1109/ICPP.2011.70}, acmid = {2066965}, publisher = {IEEE Computer Society}, address = {Washington, DC, USA}, keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, petsc_uses = {KSP} } @Article{ hakansson2013mdstochasticliouville, author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and Stulz, Eugen}, title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville equation study}, journal = {Phys. Chem. Chem. Phys.}, year = {2013}, volume = {15}, issue = {26}, pages = {10930-10941}, publisher = {The Royal Society of Chemistry}, doi = {10.1039/C3CP50788B}, petsc_uses = {KSP} } @Article{ hakansson2011stochasticliouville, author = {Hakansson, Par and Nair, Prasanth B.}, title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin form}, journal = {Phys. Chem. Chem. Phys.}, year = {2011}, volume = {13}, issue = {20}, pages = {9578-9589}, publisher = {The Royal Society of Chemistry}, doi = {10.1039/C1CP20400A}, petsc_uses = {KSP} } @InProceedings{ wang:lee:scidac2011, author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman McInnes and Todd Munson and Barry Smith}, title = {A Differential Variational Inequality Approach for the Simulation of Heterogeneous Materials}, booktitle = {Proceedings of SciDAC 2011 Conference}, year = {2011}, petsc_uses = {KSP} } @Article{ bourdinlarsenrichardson2011, author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, title = {A time-discrete model for dynamic fracture based on crack regularization}, journal = {International Journal of Fracture}, volume = {168}, issue = {2}, pages = {133--143}, doi = {10.1007/s10704-010-9562-x}, year = {2011}, petsc_uses = {KSP} } @Article{ bourdinfrancfortmarigo2008, author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, title = {The Variational Approach to Fracture}, journal = {J. Elasticity}, volume = {91}, issue = {1}, pages = {1--148}, doi = {10.1007/s10659-007-9107-3}, year = {2008}, petsc_uses = {KSP} } @Article{ lahtinen2008spectrum, title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, J.K.}, journal = {Annals of Physics}, volume = {323}, number = {9}, pages = {2286--2310}, year = {2008}, publisher = {Elsevier}, petsc_uses = {KSP} } @InProceedings{ roark2004discriminative, title = {Discriminative language modeling with conditional random fields and the perceptron algorithm}, author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational Linguistics}, pages = {47}, year = {2004}, organization = {Association for Computational Linguistics}, petsc_uses = {KSP} } @Article{ roark2007discriminative, title = {Discriminative n-gram language modeling}, author = {Roark, B. and Saraclar, M. and Collins, M.}, journal = {Computer Speech \& Language}, volume = {21}, number = {2}, pages = {373--392}, year = {2007}, publisher = {Elsevier}, petsc_uses = {KSP} } @Conference{ garcia2011parallel, title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D nanodevice simulators}}, author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and Aldegunde, M.}, booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, pages = {1--4}, organization = {IEEE}, petsc_uses = {KSP} } @Conference{ wesley2006parallel, title = {{A parallel artificial neural network implementation}}, author = {Wesley-Smith, I.}, booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, year = {2006}, petsc_uses = {KSP} } @Article{ hcsw1, author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle interactions}, journal = {Computer Physics Communications}, volumne = {181}, year = {2010}, pages = {1529--1537}, petsc_uses = {KSP} } @Article{ hh1, author = {C.-Y. Huang and F.-N. Hwang}, title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for bifurcation analysis of incompressible sudden expansion flows}, journal = {Applied Numerical Mathematics}, volume = {60}, year = {2010}, pages = {738--751}, petsc_uses = {KSP} } @Article{ hwhw1, author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for polynomial eigenvalue problems in quantum dot simulation}, journal = {Journal of Computational Physics}, volume = {229}, year = {2010}, pages = {2932--2947}, petsc_uses = {KSP} } @Article{ wei2011parallel, title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with Application in Quantum Dot Simulation}}, author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, journal = {Domain Decomposition Methods in Science and Engineering XIX}, pages = {157--164}, year = {2011}, publisher = {Springer}, petsc_uses = {KSP} } @Article{ flores2007sequential, title = {{Sequential and parallel resolution of the two-group transient neutron diffusion equation using second-degree iterative methods}}, author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, journal = {High Performance Computing for Computational Science-VECPAR 2006}, pages = {426--438}, year = {2007}, publisher = {Springer}, petsc_uses = {KSP} } @InProceedings{ gordonbell09, author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew Siegel and Won Sik Yang}, title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, note = {{SC'09 Gordon Bell} Prize Finalist}, year = {2009}, petsc_uses = {KSP} } @Article{ knepleykarpeevdavidovitseisenberggillespie10, author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. Eisenberg and Dirk Gillespie}, title = {An Efficient Algorithm for Classical Density Functional Theory in Three Dimensions: Ionic Solutions}, journal = {Journal of Physical Chemistry}, volume = {132}, number = {12}, pages = {124101--124111}, url = {http://arxiv.org/abs/0910.1531}, year = {2010}, petsc_uses = {KSP} } @Article{ knepleykarpeeveisenberggillespie09, author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, D.}, title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density Functional Theory Approach}}, journal = {Biophysical Journal}, month = feb, volume = {96}, pages = {661}, doi = {10.1016/j.bpj.2008.12.3494}, year = {2009}, petsc_uses = {KSP} } @Article{ scx2008, author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN CONCRETE}, journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, volume = {3}, number = {4}, year = {2006}, url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, petsc_uses = {KSP} } @TechReport{ kdgs2008, year = {2008}, school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic Chips}, author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. Stortia}, url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, petsc_uses = {KSP} } @Article{ springerlink:10.1007/s10915-011-9551-x, author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a Coupled FEM/SBFEM Approach}, journal = {Journal of Scientific Computing}, publisher = {Springer Netherlands}, issn = {0885-7474}, keyword = {Mathematics and Statistics}, pages = {1-22}, doi = {10.1007/s10915-011-9551-x}, petsc_uses = {KSP} } @TechReport{ jj2007, author = {Boris Jeremic and Guanzhou Jie}, title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction Problems Report}, institution = {UCD CompGeoMech 02--2007}, year = {2007}, url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, petsc_uses = {KSP} } @Unpublished{ kuiper08, title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, author = {Rolf Kuiper}, institution = {Max-Planck-Institute for Astronomy}, url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, year = {2008}, petsc_uses = {KSP} } @Article{ williamson2012multidimensional, title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, journal = {Journal of Nuclear Materials}, volume = {423}, number = {1}, pages = {149--163}, year = {2012}, publisher = {Elsevier}, petsc_uses = {KSP} } @InProceedings{ kucukboyaci2015cobra, title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB analysis}, author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in Nuclear Applications and the Monte Carlo Method}, pages = {1--18}, year = {2015}, petsc_uses = {KSP} } @Article{ hales2012solving, title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton {K}rylov Method}, author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, M.R.}, journal = {Computer Modeling in Engineering \& Sciences(CMES)}, volume = {84}, number = {2}, pages = {123--153}, year = {2012}, publisher = {Tech Science Press}, petsc_uses = {KSP} } @InProceedings{ srksyp2008, author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. Palmiotti}, title = {Fast reactor core simulations using the {UNIC} code}, booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear Power: A Sustainable Resource}, year = {2008}, petsc_uses = {KSP} } @InProceedings{ psrlkssl2007, author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. Siegel and B. Smith and E. E. Lewis}, title = {{UNIC}: Ultimate Neutronic Investigation Code}, booktitle = {Joint International Topical Meeting on Mathematics and Computation and Supercomputing in Nuclear Applications}, year = {2007}, petsc_uses = {KSP} } @InProceedings{ sprkssl2007, author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. Smith and E. E. Lewis}, title = {{PNFE} Component of the {UNIC} Code}, booktitle = {Joint International Topical Meeting on Mathematics and Computation and Supercomputing in Nuclear Applications}, year = {2007}, petsc_uses = {KSP} } @InProceedings{ dc-oop-03, author = {H. Digonnet and T. Coupez}, title = {Object-oriented programming for fast-and-easy development of parallel applications in forming processes simulation}, booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid Mechanics}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ dc-cfm-03, author = {H. Digonnet and T. Coupez}, title = {Calcul parallele en mise en forme des materiaux}, booktitle = {XVIeme Congres Francais de Mecanique}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ dsc-pcsev-04, author = {H. Digonnet and L. Silva and T. Coupez}, title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, booktitle = {Proceedings of ECCOMAS 2004}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ dsc-pca3fs-04, author = {H. Digonnet and L. Silva and T. Coupez}, title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, booktitle = {Proceedings of WCCM VI}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ dbcs-cpaac-05, author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, title = {Calcul parallele appliqu aux coulements de fluides complexe}, booktitle = {Proceedings of Eme Congres Francais de Mecanique}, year = {2005}, petsc_uses = {KSP} } @Article{ sz2010, author = {B. Smith and H. Zhang}, title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better Performance}, journal = {International Journal of High Performance Computing Applications}, volume = {25}, number = {4}, pages = {386--391}, year = {2011}, petsc_uses = {KSP} } @Article{ zssz2006, author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, journal = {TOMS}, url = {http://math.nist.gov/toms/Current.html#v33n2}, volumne = {33}, number = {2}, year = {2007}, petsc_uses = {KSP} } @Article{ gs2006, author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, title = {The detachment of a viscous drop in a viscous solution in the presence of a soluble surfactant}, journal = {Phys. Fluids}, volume = {18}, year = {2006}, url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, petsc_uses = {KSP} } @Article{ jmemsci, author = {Bo Zhou and Adam Powell}, title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation of Polymeric Membranes in 2D and 3D}, journal = {J. Membrane Sci.}, volume = {268}, number = {2}, pages = {150--164}, year = {2006}, month = jan, day = {15}, doi = {10.1016/j.memsci.2005.05.030}, petsc_uses = {KSP} } @InProceedings{ vbde2002, author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, year = {2002}, petsc_uses = {KSP} } @InProceedings{ wid2005, author = {Alexander I. Bobenko and Peter Schrader}, title = {Discrete Willmore Flow}, booktitle = {Eurographics Symposium on Geometry Processing}, url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, year = {2005}, editor = {M. Desbrun and H. Pottmann}, petsc_uses = {KSP} } @Article{ stj2003, author = {A. Scascighini and A. Troxler and R. Jeltsch}, journal = {International Journal for Numerical Methods in Fluids}, volume = {41}, issue = {4}, title = {A numerical method for inverse design based on the inverse Euler equations}, year = {2003}, pages = {339--355}, url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, petsc_uses = {KSP} } @PhDThesis{ as2001, author = {ANDREA SCASCIGHINI}, title = {A Numerical Method for the Design of Internal Flow Configurations Based on the Inverse Euler Equations}, school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, year = {2001}, url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, petsc_uses = {KSP} } @Article{ hb2005, author = {E. McKay Hyde and Oscar P. Bruno}, journal = {Journal of Computational Physics}, volume = {202}, title = {A fast, higher-order solver for scattering by penetrable bodies in three dimensions}, year = {2005}, pages = {236--261}, url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, petsc_uses = {KSP} } @MastersThesis{ d2002, author = {Matthew F Dixon}, title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING MULTI-DIMENSIONAL AMERICAN OPTIONS}, school = {READING UNIVERSITY}, year = {2002}, url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, petsc_uses = {KSP} } @TechReport{ gzb, author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, title = {Fast Parallel PageRank: A Linear System Approach}, institution = {Stanford University}, year = {2004}, url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, petsc_uses = {KSP} } @PhDThesis{ yergeau-99, author = {Daniel W. Yergeau}, title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN SEMICONDUCTORS}, school = {Stanford}, year = {1999}, url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, petsc_uses = {KSP} } @InProceedings{ rathkopf-miller-00, author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic and N.A. Gentile and N.D. Keen and T.S. Palmer}, title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, year = {2000}, booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor Physics and Mathematics and Computation into the Next Millennium}, url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, lab = {LLNL}, petsc_uses = {KSP} } @Article{ bonfi-palma-pas-05, author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, journal = {Journal of Turbomachinery}, volume = {127}, title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, year = {2005}, pages = {395-401}, petsc_uses = {KSP} } @InProceedings{ fettig-sobh-05, author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, year = {2005}, booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, petsc_uses = {KSP} } @TechReport{ melnikov-matagne-05, author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, title = {Spin configurations in circular and rectangular vertical quantum dots in a magnetic field: Three-dimensional self-consistent simulation}, year = {2005}, number = {Arxiv preprint cond-mat/0506585}, url = {http://arxiv.org/pdf/cond-mat/0506585}, petsc_uses = {KSP} } @InProceedings{ richard-smedley-03, author = {Richard P. Smedley-Stevenson}, title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, year = {2003}, booktitle = {18th International Conference on Transport Theory (18 ICTT)}, url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, petsc_uses = {KSP} } @Article{ guan-godoy-ravaioli-03, author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, journal = {Journal of Computational Electronics}, volume = {2}, title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations for Transport in a Silicon Quantum Wire Structure}, year = {2003}, pages = {335--339}, petsc_uses = {KSP} } @Article{ ovtchinnikovcai04, author = {S. Ovtchinnikov and X.-C. Cai}, journal = {Numer. Lin. Alg. Applics}, volume = {11}, title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation diffusion problem}, year = {2004}, pages = {867--881}, petsc_uses = {KSP} } @Article{ mixedstress, title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, author = {Adam Powell and David Dussault}, journal = {Appl. Numer. Anal. Comp. Math.}, volume = {2}, number = {1}, year = {2005}, pages = {157--166}, petsc_uses = {KSP} } @Article{ dhh2005, author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, journal = {International Journal for Computation and Mathematics in Electrical and Electronic Engineering (COMPEL)}, year = {2005}, petsc_uses = {KSP} } @Article{ dhh2004, author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, title = {Finite element modelling of ion convection by electrostatic forces}, journal = {IEE Proceedings Science, Measurement and Technology}, year = {2004}, volume = {151}, number = {6}, petsc_uses = {KSP} } @Article{ adams-07b, author = {Adams M.F.}, title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct Frequency Response Analysis in Solid Mechanics}, journal = {Computional Mechanics}, year = {2007}, volume = {39}, number = {4}, pages = {497-507}, petsc_uses = {KSP} } @InProceedings{ wc2004, author = {A. Wheelock and D. Cooke}, title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three Dimensions}, year = {2004}, booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, petsc_uses = {KSP} } @InProceedings{ allard-gouranton-ipts2002, author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, year = {2002}, booktitle = {Immersive Projection Technology Symposium}, url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, petsc_uses = {KSP} } @Article{ icc, author = {D Ioan and G Ciuprina and C Ciobotaru}, title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, journal = {IEEE Transactions on Magnetics}, year = {2000}, url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, petsc_uses = {KSP} } @InProceedings{ hs1, author = {Brian J. Henz and Dale R. Shires}, title = {Development and Performance Analysis of a Parallel Finite Element Application Implemented in an Object-Oriented Programming Framework}, year = {2003}, booktitle = {PDPTA 2003}, pages = {1286-1292}, note = {Resin Transfer Modeling}, petsc_uses = {KSP} } @TechReport{ b2000, author = {Rickard Bergstrom}, title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, year = {2000}, institution = {Chalmers}, number = {2000-05}, url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, petsc_uses = {KSP} } @Article{ fs2004, author = {Petri Fast and Michael J. Shelley}, title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele Shaw Flow}, journal = {Journal of Computational Physics}, year = {2004}, volume = {195}, url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, pages = {117-142}, petsc_uses = {KSP} } @MastersThesis{ wallach, author = {Hanna Wallach}, title = {Efficient Training of Conditional Random Fields}, school = {University of Edinburgh}, year = {2002}, url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ }osborne/msc-projects/wallach.ps.gz}, petsc_uses = {KSP} } @Article{ something, author = {T Rylander and A Bondeson}, title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells equations}, journal = {Journal of Computational Physics}, year = {2002}, volume = {179}, pages = {426-438}, petsc_uses = {KSP} } @TechReport{ uf1, author = {Uwe Fabricius}, title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an electrostatic problem}, year = {2004}, institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, number = {04-1}, petsc_uses = {KSP} } @InBook{ sg1, author = {Natalia Seoane and A.J.Garca-Loureiro}, chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity Equation}, url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, title = {Lecture Notes in Computer Science}, publisher = {Springer-Verlag}, volume = {3037}, year = {2004}, petsc_uses = {KSP} } @Article{ nikyilmazgivisheikhipope10, author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, journal = {AIAA Journal}, volume = {48}, number = {7}, pages = {1513--1522}, year = {2010}, petsc_uses = {KSP} } @Article{ nikyilmazsheikhigivi10, author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, title = {Grid Resolution Effects on VSFMDF/LES}, journal = {Flow, Turbulence and Combustion}, doi = {10.1007/s10494-010-9272-5}, year = {2010}, petsc_uses = {KSP} } @Article{ idema2013towards, title = {Towards faster solution of large power flow problems}, author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis and van der Sluis, Lou}, journal = {Power Systems, IEEE Transactions on}, volume = {28}, number = {4}, pages = {4918--4925}, year = {2013}, publisher = {IEEE}, petsc_uses = {KSP} } @Article{ 6026245, author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, journal = {Power Systems, IEEE Transactions on}, title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, year = {2012}, month = feb, volume = {27}, number = {1}, pages = {390-396}, doi = {10.1109/TPWRS.2011.2165860}, issn = {0885-8950}, petsc_uses = {KSP} } @Book{ idema2014computational, title = {Computational Methods in Power System Analysis}, author = {Idema, Reijer and Lahaye, Domenico JP}, year = {2014}, publisher = {Springer}, petsc_uses = {KSP} } @PhDThesis{ abhyankar2011thesis, author = {Shrirang Abhyankar}, title = {Development of an implicitly coupled electromechanical and electromagnetic transients simulator for power systems}, school = {Illinois Institute of Technology}, year = {2011}, petsc_uses = {KSP} } @InProceedings{ abhyankarhipcna11-1, author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, title = {Using {PETSc} to develop scalable applications for next-generation power grid}, year = {2011}, booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, Networking and Analytics for the Power Grid}, url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, publisher = {ACM}, petsc_uses = {KSP} } @InProceedings{ abhyankarhipcna11-2, author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, title = {Development of a parallel three-phase transient stability simulator for power systems}, year = {2011}, booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, Networking and Analytics for the Power Grid}, publisher = {ACM}, petsc_uses = {KSP} } @InProceedings{ abhyankarpesgeneral2012, author = {Shrirang Abhyankar and A. Flueck}, title = {An implicitly-coupled solution approach for combined electromechanical and electromagnetic transients simulation}, year = {2012}, booktitle = {Proceedings of the IEEE PES General Meeting}, publisher = {IEEE}, petsc_uses = {KSP} } @Article{ idemalahayevuiksluis2012, author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, title = {Scalable Newton-Krylov solver for very large Power Flow problems}, journal = {IEEE Transactions on Power Systems}, year = {2012}, volume = {27}, pages = {390-396}, petsc_uses = {KSP} } @Article{ korrestzavellasgalinas2013, author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, title = {A distributed implementation of multi-area power system state estimation on a cluster of computers }, journal = {Electric Power Systems Research }, volume = {102}, number = {0}, pages = {20 - 32}, year = {2013}, issn = {0378-7796}, doi = {10.1016/j.epsr.2013.04.002}, petsc_uses = {KSP} } % LiteralHTML:
% LiteralHTML: % LiteralHTML: Material failure, for example, cracking of steel beams resulting % LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations % LiteralHTML: are important for prediction and prevention. PETSc has been used % LiteralHTML: in a variety of studies of material failure.

% LiteralHTML:
% LiteralHTML: @InProceedings{ gray2, author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, year = {2004}, booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, petsc_uses = {KSP} } @InProceedings{ gray1, author = {J. Gray and C. Homescu and L. Petzold and Richard Alkire}, title = {Algorithms and Computing Architectures for Solving Differential-Algebraic Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, year = {2003}, booktitle = {Abstracts of the Electrochemical Society 204th meeting}, petsc_uses = {KSP} } @InProceedings{ crack2, author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials Conference}, url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, year = {2003}, petsc_uses = {KSP} } @TechReport{ hdams1, author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and Lynd Stringer}, title = {Fracture Mechanics on the Intel Itanium Architecture}, year = {2001}, institution = {Intel Corporation}, url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, petsc_uses = {KSP} } @InProceedings{ ihwi, author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, booktitle = {International Conference ON Computational Engineering and Sciences}, year = {2002}, url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, petsc_uses = {KSP} } @InProceedings{ crack, author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis and Paul A. Wawrzynek}, title = {Parallel FEM Simulation of Crack Propagation}, booktitle = {Proceedings of Irregular 2000}, url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, year = {2000}, petsc_uses = {KSP} } @InProceedings{ beaudoin98, author = {A. J. Beaudoin}, title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, booktitle = {Simulation of materials processing: Theory, methods, and applications - Proceedings of the Sixth International Conference, NUMIFORM'98}, editor = {J. Hu\'etink and F. P. T. Baaijens}, optvolume = {}, optnumber = {}, optseries = {}, year = {1998}, optorganization={}, publisher = {A. A. Balkema Publishers}, address = {Rotterdam, Netherlands}, month = jun, optpages = {}, petsc_uses = {KSP} } % LiteralHTML:
@TechReport{ defordheld1, author = {JF DeFord and BL Held}, title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, year = {2002}, institution = {Simulation Technology and Applied Research}, url = {http://www.staarinc.com/support/papers/aces2002.pdf}, note = {Discusses their parallel commercial solver that uses PETSc}, petsc_uses = {KSP} } @PhDThesis{ sande2003, author = {Hans Vande Sande}, title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic Quasi-Static Electromagnetic Systems}, school = {Katholieke Universiteit Leuven, Belgium}, year = {2003}, petsc_uses = {KSP} } @Article{ sdchh2004, author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System Tolerance}, journal = {IEEE Transactions on Magnetics}, year = {2004}, volume = {40}, pages = {1306--1309}, petsc_uses = {KSP} } @Article{ holst-lindblom-etal:2004, author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. Scheel and Lawrence E. Kidder}, title = {Optimal constraint projection for hyperbolic evolution systems, }, journal = {Phys. Rev. D}, year = {2004}, volume = {70}, pages = {084017}, petsc_uses = {KSP} } @Article{ marm2005, author = {Matthew Anderson and Richard A. Matzner}, title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, journal = {Foundations of Physics}, volume = {35}, pages = {1572--9516}, year = {2005}, petsc_uses = {KSP} } @Article{ cook-pfeiffer:2004, author = {Cook, Gregory B. and Pfeiffer, Harald P.}, title = {Excision boundary conditions for black hole initial data}, journal = {Phys. Rev. D}, volume = {70}, pages = {104016--24}, year = {2004}, petsc_uses = {KSP} } @Article{ pfeiffer-kidder-etal:2005, author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre Shoemaker}, title = {Initial data for {E}instein's equations with superposed gravitational waves}, journal = {Phys. Rev. D}, year = {2005}, volume = {71}, pages = {024020}, petsc_uses = {KSP} } @Article{ pfeiffer-kidder-etal:2003, author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, Saul A.}, title = {A multidomain spectral method for solving elliptic equations}, journal = {CPC}, year = {2003}, volume = {152}, pages = {253--273}, note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. For a related online version, see arXiv:gr-qc/0202096}, petsc_uses = {KSP} } @Article{ pfeiffer-cook-teukolsky:2002, author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, title = {Comparing initial-data sets for binary black hole}, journal = {PRD}, year = {2002}, volume = {66}, pages = {024047}, note = {for a related online version, seearXiv:gr-qc/0203085}, petsc_uses = {KSP} } @PhDThesis{ pfeiffer:2003, author = {Pfeiffer, Harald P.}, title = {Initial Data for Black Hole Evolutions}, school = {Cornell University}, year = {2003}, petsc_uses = {KSP} } @TechReport{ h1, author = {Erik Schnetter}, title = {A fast apparent horizon algorithm}, year = {2002}, number = {Arxiv preprint gr-qc/0206003}, url = {http://arxiv.org/pdf/gr-qc/0206003}, petsc_uses = {KSP} } @Article{ h2, author = {Erik Schnetter}, title = {Finding apparent horizons and other 2-surfaces of constant expansion}, year = {2003}, journal = {Class. Quantum Grav.}, pages = {4719-4737}, volume = {20}, url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, petsc_uses = {KSP} } @Article{ adams-03a, author = {Adams, M.~F.}, journal = {Numerical Linear Algebra with Applications}, number = {2-3}, pages = {141-153}, title = {Algebraic multigrid methods for constrained linear systems with applications to contact problems in solid mechanics}, volume = {11}, year = {2004}, petsc_uses = {KSP} } @Article{ vandesande1, author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2003}, volume = {39}, pages = {1709--1712}, title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, petsc_uses = {KSP} } @InProceedings{ vbde1, author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, year = {2002}, title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the Uintah PSE}, booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 2002}, pages = {49-55}, url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, note = {Extended abstract}, petsc_uses = {KSP} } @Unpublished{ ep1, title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, author = {Bradley R. Eccleston and Todd S. Palmer}, institution = {Department of Nuclear Engineering, Oregon State University}, url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale Parallel Simulations}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ teo2007scalable, title = {A scalable modular convex solver for regularized risk minimization}, author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge discovery and data mining}, pages = {727--736}, year = {2007}, organization = {ACM}, petsc_uses = {KSP} } @InProceedings{ rm02, author = {Robert Malouf}, year = {2002}, title = {A comparison of algorithms for maximum entropy Parameter estimation}, booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning (CoNLL-2002)}, pages = {49-55}, url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, petsc_uses = {KSP} } @Unpublished{ hrv02, title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, author = {V. Hernandex and J. E. Roman and V. Vidal}, note = {Submitted to CMMSE}, petsc_uses = {KSP} } @Article{ tmh2001, author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, journal = {Journal of Economic Dynamics and Control}, year = {2002}, volume = {26}, pages = {1499-1515}, title = {Solving finite difference schemes arising in trivariate option pricing}, petsc_uses = {KSP} } @InProceedings{ a2, author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, title = {Comparison of three algorithms for nonlinear metal cutting problems}, booktitle = {Proceedings of the 11th International Conference on Domain Decomposition Methods}, editor = {C.-H. Lai et al.}, publisher = {Domain Decomposition Press, Bergen}, url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, year = {1999}, petsc_uses = {KSP} } @Unpublished{ mmmdcmaa-web-page, title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and {A}coustics {W}eb Page}, url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, author = {David E. Keyes}, institution = {Old Dominion University}, petsc_uses = {KSP} } @Conference{ liu2010parallelization, title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, booktitle = {International Symposium on Parallel and Distributed Processing with Applications}, pages = {528--535}, year = {2010}, organization = {IEEE}, petsc_uses = {KSP} } @Unpublished{ oil-reservoir-sim-web-page, title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, url = {http://www.pe.utexas.edu/CPGE/new_generation}, institution = {University of Texas at Austin and Argonne National Laboratory}, key = {University of Texas at Austin and Argonne National Laboratory}, petsc_uses = {KSP} } @Article{ tmh2001b, author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, journal = {IEEE TRANSACTIONS ON MAGNETICS }, year = {2001}, volume = {37}, pages = {143--146}, title = {Adapting EMAP3D to parallel processing}, petsc_uses = {KSP} } @Article{ harbury98, author = {HK Harbury and W Porod}, journal = {VLSI Design}, year = {1998}, volume = {6}, pages = {47--51}, title = {Parallel computation for electronic waves in quantum corrals}, petsc_uses = {KSP} } @Article{ bludszuwei98, author = {Mark Bludszuweit}, journal = {Journal of Lightwave Technology}, year = {1998}, volume = {16}, number = {7}, pages = {1336--42}, title = {Mixed Finite Element Beam Propagation Method}, petsc_uses = {KSP} } @Article{ s1, author = {J. L. Friedman and N. Stergioulas}, journal = {Astrophysics Journal}, year = {1998}, volume = {492}, number = {301}, pages = {}, title = {}, petsc_uses = {KSP} } @Article{ s1a, author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, journal = {Astrophysics Journal}, year = {1999}, volume = {510}, number = {854}, pages = {}, title = {}, petsc_uses = {KSP} } @PhDThesis{ s2, author = {N. Stergioulas}, title = {Ph. D. thesis}, year = {1996}, institution = {University of Wisconsin-Milwaukee}, petsc_uses = {KSP} } @InProceedings{ coral1, author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and Parallel Computing Environment}, booktitle = {Proceedings of the Miami TEAM Workshop}, location = {Florida International University, Department of Electrical Engineering and Computing Science}, month = nov, year = {1993}, petsc_uses = {KSP} } @InProceedings{ coral2, author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, month = dec, year = {1994}, petsc_uses = {KSP} } @InProceedings{ coral3, author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, location = {Florida International University, Department of Electrical Engineering and Computing Science}, year = {1995}, petsc_uses = {KSP} } @InProceedings{ mijalkovic, author = {Slobodan Mijalkovi\'{c}}, title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor Process Simulation}, booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held Gent, Belgium, September 27--30, 1999.}, editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, optvolume = {14}, optseries = {Lecture Notes in Computational Science and Engineering}, year = {2000}, publisher = {Springer}, address = {Berlin}, optpages = {179--184}, petsc_uses = {KSP} } @Article{ bludszuwei98a, author = {Mark Bludszuweit}, journal = {Journal of Lightwave Technology}, year = {1998}, volume = {16}, number = {7}, pages = {1336--42}, title = {Mixed Finite Element Beam Propagation Method}, petsc_uses = {KSP} } @Article{ gilli-pauletto-1998, author = {Manfred Gilli and Giorgio Pauletto}, title = {Parallel {K}rylov Methods for Econometric Model Simulation}, journal = {Computational Economics}, year = {2000}, volume = {16}, pages = {173--186}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Software Packages that use or interface to PETSc

% LiteralHTML: @Article{ collierdalcincalo2013, title = {{PetIGA}: High-Performance Isogeometric Analysis}, author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, journal = {arxiv}, year = {2013}, number = {1305.4452}, note = {\url{http://arxiv.org/abs/1305.4452}}, petsc_uses = {KSP} } @Article{ collierdalcinvignalcortescalo2016, title = {PetIGA: A framework for high-performance isogeometric analysis}, author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and Victor M. Calo}, journal = {Computer Methods in Applied Mechanics and Engineering}, year = {2016}, petsc_uses = {KSP} } @Misc{ petiga-web-page, author = {N. Collier and L. Dalcin and V.M. Calo}, title = {{PetIGA} {W}eb page}, url = {https://bitbucket.org/dalcinl/petiga/}, howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, year = {2014}, petsc_uses = {KSP} } @Article{ logg07, author = {Logg, Anders}, title = {Automating the Finite Element Method}, journal = {Archives of Computational Methods in Engineering}, volume = {14}, number = {2}, pages = {93-138}, year = {2007}, doi = {10.1007/s11831-007-9003-9}, publisher = {Kluwer Academic Publishers}, issn = {1134-3060}, language = {English}, petsc_uses = {KSP} } @Article{ jezequelcouturierdenis12, author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, title = {Solving large sparse linear systems in a grid environment: the GREMLINS code versus the PETSc library}, journal = {The Journal of Supercomputing}, volume = {59}, number = {3}, pages = {1517-1532}, year = {2012}, issn = {0920-8542}, doi = {10.1007/s11227-011-0563-y}, publisher = {Springer US}, keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; Sparse linear solver}, language = {English}, petsc_uses = {KSP} } @Unpublished{ feap-web-page, title = {FEAP: A Finite Element Analysis Program}, url = {http://www.ce.berkeley.edu/projects/feap/}, author = {FEAP Team}, note = {Uses PETSc linear solvers - iterative and direct}, petsc_uses = {KSP} } @Unpublished{ parpre-web-page, title = {{ParPre} {W}eb {P}age}, url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, institution = {University of Tennessee}, author = {Victor Eijkhout}, note = {This is no longer supported. A set of preconditioners built on PETSc}, petsc_uses = {KSP} } @Unpublished{ pism, title = {{PISM}: a Parallel Ice Sheet Model}, author = {{PISM Team}}, abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice Sheet Model). The thickness, temperature, velocity and age of the ice are all simulated, as is the deformation of the earth underneath the ice. New techniques for fast ice dynamics, earth deformation, and verification have are included.}, note = {\url{http://www.pism-docs.org/}}, petsc_uses = {KSP} } @Unpublished{ oofem, title = {OOFEM - an object oriented finite element package}, author = {Borek Patzak}, url = {http://www.oofem.org}, petsc_uses = {KSP} } @Unpublished{ dks2openfvm, title = {OpenFVM - a finite volume based general purpose CFD solver}, author = {Open source development}, url = {http://openfvm.sourceforge.net/}, petsc_uses = {KSP} } @Unpublished{ sundar-2008w, title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on octree meshes}, author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, institution = {University of Pennsylvania}, url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, petsc_uses = {KSP} } @Unpublished{ khatiwala07-software, title = {A computational framework for simulation of biogeochemical tracers in the ocean}, author = {Khatiwala, S.}, institution = {Columbia University}, url = {http://www.ldeo.columbia.edu/\~{ }spk}, petsc_uses = {KSP} } @InBook{ jiaolima99, author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, url = {http://portal.acm.org/citation.cfm?id=646895.709725}, title = {Lecture Notes in Computer Science}, publisher = {Springer-Verlag}, volume = {1732}, year = {1999}, petsc_uses = {KSP} } @Article{ crow1, author = {C. S. Crow IV}, title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, journal = {Hopkins Undergraduate Research Journal}, year = {2003}, url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, petsc_uses = {KSP} } @Unpublished{ petsc-python, title = {PETSc for Python}, author = {L. Dalcin}, url = {https://petsc.org/main/petsc4py}, note = {Provides Python bindings for PETSc}, } @Unpublished{ cfdship, title = {{CFDShip-Iowa}}, author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, institution = {University of Iowa}, url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset structured grids, designed for ship applications}, petsc_uses = {KSP} } @Unpublished{ bvw, title = {Multiflow}, author = {Berend van Wachem}, institution = {Mechanical Engineering - Chalmers University of Technology}, url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase flows.}, petsc_uses = {KSP} } @Unpublished{ dks2, title = {FENA - A Finite Element Model for the North Atlantic}, author = {Jens Schroeter}, institution = {Alfred-Wegener-Institute for Polar and Marine Research}, url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, petsc_uses = {KSP} } @TechReport{ piwonski2010idea, title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in {3-D}}, author = {Piwonski, J. and Slawig, T.}, year = {2010}, institution = {Christian-Albrechts-Universit\"at zu Kiel}, url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, petsc_uses = {KSP} } @Unpublished{ metos3d-web, title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, author = {Piwonski, J. and Slawig, T.}, institution = {Christian-Albrechts-Universit\"at zu Kiel}, url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, petsc_uses = {KSP} } @Unpublished{ magpar, author = {W. Scholz}, title = {Magpar: Parallel Micromagnetics Code}, institution = {Vienna University of Technology}, url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, petsc_uses = {KSP} } @Misc{ libmesh:sourceforge, author = {}, title = {{libMesh}:a C++ framework for the numerical simulation of partial differential equations on serial and parallel platforms}, note = {[Online]}, url = {http://libmesh.github.io}, petsc_uses = {KSP} } @Misc{ moose-web-page, title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek Gaston and John Peterson and Jason Miller}, institution = {Idaho National Laboratory}, howpublished = {\url{http://mooseframework.org}}, petsc_uses = {KSP} } @Article{ gaston2009moose, title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear equations}, author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, journal = {Nuclear Engineering and Design}, volume = {239}, number = {10}, pages = {1768--1778}, year = {2009}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ tonks2012object, title = {An object-oriented finite element framework for multiphysics phase field simulations}, author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, journal = {Computational Materials Science}, volume = {51}, number = {1}, pages = {20--29}, year = {2012}, publisher = {Elsevier}, petsc_uses = {KSP} } @Misc{ pylithmanual, author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif Strand and Charles Williams}, title = {{PyLith} User Manual Version 2.0.0}, year = {2014}, url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, petsc_uses = {KSP} } @Misc{ pylith-web-page, author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, title = {{PyLith}}, year = {2012}, url = {http://geodynamics.org/resources/pylith/}, howpublished = {\url{http://geodynamics.org/resources/pylith/}}, petsc_uses = {KSP} } @Misc{ galemanual, author = {Walter Landry and Luke Hodkinson and Susan Kientz}, title = {Gale User Manual Version 2.0.0}, year = {2011}, url = {http://geodynamics.org/cig/software/gale/gale.pdf}, petsc_uses = {KSP} } @Unpublished{ underworld, author = {Louis Moresi}, title = {{UnderWorld}: A Geodynamics Modelling Code}, institution = {Monash University}, url = {http://www.mcc.monash.edu/twiki/view/Codes}, petsc_uses = {KSP} } @Article{ moresi2007computational, title = {Computational approaches to studying non-linear dynamics of the crust and mantle}, author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and M{\"u}hlhaus, H.B.}, journal = {Physics of the Earth and Planetary Interiors}, volume = {163}, number = {1-4}, pages = {69--82}, year = {2007}, publisher = {Elsevier}, petsc_uses = {KSP} } @Article{ pitt2009chaste, title = {Chaste: a test-driven approach to software development for biological modelling}, author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. and Walter, A. and others}, journal = {Computer Physics Communications}, volume = {180}, number = {12}, pages = {2452--2471}, year = {2009}, publisher = {Elsevier}, petsc_uses = {KSP} } @Misc{ fenicsproject, title = {{The FEniCS project}}, author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, note = {A continually updated technical report. \url{http://fenicsproject.org}}, url = {http://fenicsproject.org}, year = {2011}, petsc_uses = {KSP} } @Unpublished{ snark, title = {Snark: A suite of software for geoscientific applications and a philosophy of scientific software development}, institution = {Victorian Partnership for Advanced Computing}, url = {http://vpac.org/Snark}, petsc_uses = {KSP} } @Misc{ imoose:sourceforge, author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, note = {[Online]}, url = {http://imoose.sourceforge.net}, petsc_uses = {KSP} } @Unpublished{ fossi, author = {Stephan Frickenhaus}, title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector codes}, institution = {AWI-Bremerhaven, Germanny}, url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, petsc_uses = {KSP} } @Unpublished{ fun3dweb, author = {Dinesh Kaushik}, title = {PETSC-FUN3D Benchmark Page}, institution = {ODU/ANL}, url = {http://www.mcs.anl.gov/petsc-fun3d}, note = {CFD Benchmark of some solvers in PETSc}, petsc_uses = {KSP} } @Unpublished{ scirun, author = {SCIRun Development Team}, title = {SCIRun}, institution = {University of Utah}, url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, note = {SCIRun now uses PETSc linear solvers}, petsc_uses = {KSP} } @Misc{ prometheus, author = {Mark F. Adams}, title = {Prometheus - A scalable unstructured finite element solver}, institution = {Berkeley}, howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, petsc_uses = {KSP} } @Unpublished{ illuminator, author = {Adam C. Powell, IV}, title = {Illuminator Distributed Visualization Library}, url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, petsc_uses = {KSP} } @Unpublished{ rheoplast, title = {RheoPlast Phase Field Multi-Physics Code}, author = {Adam Powell and David Dussault and Bo Zhou}, url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, petsc_uses = {KSP} } @Misc{ tao-web-page, title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, howpublished = {\url{http://www.mcs.anl.gov/tao}}, petsc_uses = {KSP} } @TechReport{ tao-user-ref, title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild and Steve Benson and Lois Curfman McInnes}, institution = {Argonne National Laboratory}, year = {2019}, number = {ANL/MCS-TM-322 - Rev 3.12}, petsc_uses = {KSP} } % url = "http://www.mcs.anl.gov/tao", @Unpublished{ mefpp-web-page, title = {{MEF++} {W}eb {P}age}, url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, author = {Eric Chamberland}, note = {A finite element code for fluid dynamics, solid mechanics, thermal and multiphysics}, petsc_uses = {KSP} } @Unpublished{ tipetsc-titanium, title = {Ti-PETSc - an interface to PETSc from Titanium}, institution = {Berkeley}, author = {He, Yun and Liblit, Bun and Lin, Chang}, url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, year = {1999}, petsc_uses = {KSP}, } @Unpublished{ ptatin-web-page, title = {ptatin3d}, author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, url = {https://bitbucket.org/jedbrown/ptatin3d}, year = {2018}, petsc_uses = {KSP} } @Misc{ multiphase-web-page, author = {Q. Zou}, title = {Multiphase flow with {PETSc}}, institution = {LANL}, howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, url = {http://cnls-www.lanl.gov/\~{ }qzou}, lab = {LANL}, petsc_uses = {KSP} } @Misc{ electromag-web-page, title = {{EMSolve Web} page}, institution = {LLNL}, howpublished = {http://www.llnl.gov/casc/emsolve}, url = {http://www.Llnl.gov/casc/emsolve}, author = {Daniel {White et al.}}, lab = {LLNL}, petsc_uses = {KSP} } @Unpublished{ fe-software-web-page, institution = {Kuleuven}, title = {Finite element software}, url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, petsc_uses = {KSP} } @Misc{ petsc-web-page, author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao Zhang}, title = {{PETS}c {W}eb page}, url = {https://petsc.org/}, howpublished = {\url{https://petsc.org/}}, year = {2024} } @Unpublished{ petsc-debian-package, author = {Adam C. Powell, IV}, title = {Debian package for PETSc}, url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, petsc_uses = {KSP} } @Unpublished{ cactus, title = {Cactus Website}, url = {http://www.cactuscode.org/}, note = {Provides two interface to the PETSc solvers}, petsc_uses = {KSP} } @Unpublished{ petsc-fem, author = {Mario Storti and Norberto Nigro}, title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, url = {http://www.cimec.org.ar/petscfem}, petsc_uses = {KSP} } @Misc{ fidap, title = {FIDAP 8.5}, howpublished = {\url{http://www.fluent.com}}, url = {http://www.fluent.com}, note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear solves.}, key = {FIDAP 8.5}, petsc_uses = {KSP} } @Unpublished{ slepc, author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and Vicente Hern\'andez and Vicent Vidal}, title = {{SLEPc} Website}, url = {http://slepc.upv.es/}, note = {Scalable Library for Eigenvalue Problem Computations}, petsc_uses = {KSP} } @TechReport{ slepc-users-manual, author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and Vicente Hern\'andez and Vicent Vidal}, title = {{SLEPc} Users Manual}, number = {DISC-II/24/02}, url = {http://slepc.upv.es/}, note = {Scalable Library for Eigenvalue Problem Computations}, petsc_uses = {KSP} } @Misc{ deal.ii, title = {deal.II}, howpublished = {\url{http://www.dealii.org}}, url = {http://www.dealii.org}, note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. It allows PETSc linear algebra and solvers to be used underneath.}, key = {deal.II 5.0}, petsc_uses = {KSP} } @Article{ bangerth2007deal, title = {{deal.II---A general-purpose object-oriented finite element library}}, author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {33}, number = {4}, pages = {24--es}, issn = {0098-3500}, year = {2007}, publisher = {ACM}, petsc_uses = {KSP} } @Misc{ globalarrays, author = {Jarek {Nieplocha et al.}}, title = {Global Arrays}, institution = {Pacific Northwest National Laboratories}, howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, url = {http://www.emsl.pnl.gov/docs/global}, note = {Global arrays can use PETSc linear solvers}, lab = {PNNL}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Software Engineering

% LiteralHTML: @Article{ petsccommunity2022, title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User Community}, author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang and Hong Zhang and Junchao Zhang}, journal = {Computing in Science and Engineering}, volume = {24}, number = {03}, pages = {6--15}, issn = {1558-366X}, doi = {10.1109/MCSE.2022.3169974}, publisher = {IEEE Computer Society}, address = {Los Alamitos, CA, USA}, month = may, year = {2022}, url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, petsc_uses = {KSP} } @Article{ brownknepleysmith14, author = {Jed Brown and Matthew G. Knepley and Barry Smith}, title = {Run-time extensibility and librarization of simulation software}, journal = {IEEE Computing in Science and Engineering}, month = jan, volume = {17}, number = {1}, pages = {38--45}, doi = {10.1109/MCSE.2014.95}, year = {2015}, petsc_uses = {KSP} } @TechReport{ ass2012, author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, institution = {Argonne National Laboratory}, type = {Preprint}, year = {2012}, number = {ANL/MCS-P2011-0112}, petsc_uses = {KSP} } @TechReport{ clearyknepley99, author = {Andrew Cleary and Matthew G. Knepley}, title = {Solvers as Operators}, institution = {Lawrence Livermore National Laboratory}, type = {Technical Report}, number = {UCRL-ID-135342}, year = {1999}, petsc_uses = {KSP} } @TechReport{ smcabbkz2012, author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, title = {{PETSc's} software strategy for the design space of composable extreme-scale solvers}, institution = {Argonne National Laboratory}, type = {Preprint}, note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, year = {2012}, number = {ANL/MCS-P2059-0312}, petsc_uses = {KSP} } @InProceedings{ mhwpmhs2009, author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin and G. E. Hammond and B. Smith}, title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing Toolkit {MPI} at Scale}, booktitle = {Cray Users Group Conference}, year = {2009}, petsc_uses = {KSP} } @InProceedings{ msmhls2010, author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. Lichtner and B. F. Smith}, title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} {BlueGene} Architectures}, booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, year = {2010}, petsc_uses = {KSP} } @InCollection{ msk2013, author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, title = {Preliminary Implementation of {PETSc} Using {GPUs}}, booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, series = {Lecture Notes in Earth System Sciences}, editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and Yaolin Shi}, doi = {10.1007/978-3-642-16405-7_7}, publisher = {Springer Berlin Heidelberg}, pages = {131--140}, year = {2013}, isbn = {978-3-642-16404-0}, petsc_uses = {KSP} } @InCollection{ knepleyyuen13, author = {Matthew G. Knepley and David A. Yuen}, title = {Why Scientists and Engineers need {GPU}s today}, booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, series = {Lecture Notes in Earth System Sciences}, editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and Yaolin Shi}, doi = {10.1007/978-3-642-16405-7_1}, publisher = {Springer Berlin Heidelberg}, pages = {131--140}, year = {2013}, isbn = {978-3-642-16404-0}, petsc_uses = {KSP} } @InCollection{ karpeevknepleybrune13, author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, title = {Accurate Evaluation of Local Averages on {GPGPUs}}, booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, series = {Lecture Notes in Earth System Sciences}, editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and Yaolin Shi}, doi = {10.1007/978-3-642-16405-7_30}, publisher = {Springer Berlin Heidelberg}, pages = {487--501}, year = {2013}, isbn = {978-3-642-16404-0}, petsc_uses = {KSP} } @InCollection{ zhengetal13, title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly Variable Viscosity}, author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai Zhang and Yaolin Shi}, booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, series = {Lecture Notes in Earth System Sciences}, editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and Yaolin Shi}, doi = {10.1007/978-3-642-16405-7_21}, publisher = {Springer Berlin Heidelberg}, pages = {321--333}, year = {2013}, isbn = {978-3-642-16404-0}, petsc_uses = {KSP} } @Article{ zhengetal13b, title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with strongly variable viscosity based on {M}atlab and {CUDA}}, author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai Zhang and Yaolin Shi}, journal = {IJHPCA}, volume = {28}, number = {1}, pages = {50--60}, doi = {10.1177/1094342013478640}, year = {2013}, petsc_uses = {KSP} } @InBook{ s2011, author = {B. Smith}, chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, title = {Encyclopedia of Parallel Computing}, bookeditor = {D. Padua}, publisher = {Springer}, year = {2011}, petsc_uses = {KSP} } @Article{ acostamejia06, author = {Carlos D. Acosta and Carlos E. Mej\'ia}, title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, journal = {Lecturas Matem\'aticas}, volume = {27}, year = {2006}, pages = {213--224}, petsc_uses = {KSP} } @InProceedings{ quenettemoresisunterappelbe07, author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, title = {Explaining StGermain: An aspect oriented environment for building extensible computational mechanics modeling software}, booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, publisher = {IEEE}, pages = {1--8}, yerar = {2007}, petsc_uses = {KSP} } @Article{ dfm1, title = {Vectorized sparse matrix multiply for compressed row storage format}, author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, journal = {Lecture Notes in Computer Science}, year = {2005}, pages = {99--106}, volume = {3514}, lab = {ORNL}, petsc_uses = {KSP} } @InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan Vandewalle and Stefaan Poedts}, title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented Scientific Computing Software}, booktitle = {Computational Science ICCS 2005: 5th International Conference}, year = {2005}, note = {Lecture Notes in Computer Science}, volume = {3514}, publisher = {Springer-Verlag GmbH}, petsc_uses = {KSP} } @InProceedings{ dalcin-paz-storti, author = {L. Dalcin and R. Paz and M. Storti}, title = {Desarrollo de Aplicaciones Paralelas en Python}, booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). Bariloche, Argentina}, year = {2004}, petsc_uses = {KSP} } @Article{ mpi-python, author = {L. Dalcin and R. Paz and M. Storti}, title = {MPI for Python}, journal = {Journal of Parallel and Distributed Computing}, year = {2005}, petsc_uses = {KSP} } @Unpublished{ hrv02a, title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, author = {V. Hernandex and J. E. Roman and V. Vidal}, note = {Submited to VecPar 2002}, year = {2002}, petsc_uses = {KSP} } @Article{ knyazev2007block, title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and {PETSc}}, author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, journal = {SIAM Journal on Scientific Computing}, volume = {29}, pages = {2224-2239}, doi = {10.1137/060661624}, year = {2007}, petsc_uses = {KSP} } @MastersThesis{ aarrestad-master, author = {Asbjorn Hoiland Aarrestad}, title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, school = {University of Bergen}, month = aug, year = {2003}, url = {http://www.parallab.uib.no/projects/molecul/matrix/}, note = {Implemented Runge-Kutta methods using PETSc}, petsc_uses = {KSP} } @PhDThesis{ kaushik-phd, author = {D. K. Kaushik}, title = {Performance Modeling and Prediction for the Scalable Solution of Partial Differential Equations on Unstructured Grids}, school = {Old Dominion University}, month = dec, year = {2002}, url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, petsc_uses = {KSP} } @TechReport{ rb1, author = {Rickard Bergstrom}, title = {Object Oriented Implementation of a General Finite Element Code}, number = {2002-13}, institution = {Chalmers Finite Element Center, Chalmers University of Technology}, year = {2002}, url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, note = {Discribes a finite element software package that uses PETSc for its solvers}, petsc_uses = {KSP} } @InProceedings{ dbl1, author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, title = {A Parallel General Purpose Finite Element System}, booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, publisher = {SIAM}, year = {1999}, url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, note = {Describes software that uses PETSc for its parallel linear solves}, petsc_uses = {KSP} } @Article{ p1, title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes and B. Smith}, journal = {Parallel Computing}, year = {2002}, pages = {1811--1831}, volume = {28 (12)}, petsc_uses = {KSP} } @Article{ automatic-ad, author = {Paul Hovland and Boyana Norris and Barry Smith}, title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, year = {2005}, journal = {Future Generation Computer Systems}, volume = {21}, number = {8}, pages = {1426--1438}, petsc_uses = {KSP} } @TechReport{ remote-math, author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry Smith}, title = {Remote Access to Mathematical Software}, number = {ANL/MCS-P889-0601}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, month = jun, year = {2001}, url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, petsc_uses = {KSP} } @InProceedings{ gropp98, author = {William D. Gropp}, title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, publisher = {SIAM}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, year = {1999}, pages = {21-29}, petsc_uses = {KSP} } @InProceedings{ knepleysarin99, author = {Matthew Knepley and Vivek Sarin}, title = {Algorithm Development for Large Scale Computing}, publisher = {SIAM}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, year = {1999}, petsc_uses = {KSP} } @InBook{ bgms00, author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, chapter = {Software for the Scalable Solution of {PDEs}}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, title = {CRPC Handbook of Parallel Computing}, editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon and A. White}, publisher = {Morgan Kaufmann Publishers}, year = {2002}, petsc_uses = {KSP} } @InProceedings{ hovland_norris_smith98, author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific Computations}, publisher = {SIAM}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, note = {also available as Argonne preprint ANL/MCS-P731-1098}, year = {1999}, pages = {129-137}, petsc_uses = {KSP} } @InProceedings{ efficient, author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, title = {Efficient Management of Parallelism in Object Oriented Numerical Software Libraries}, booktitle = {Modern Software Tools in Scientific Computing}, editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, publisher = {Birkhauser Press}, pages = {163--202}, year = {1997}, petsc_uses = {KSP} } % url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" @TechReport{ petsc-user-ref, author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich and Barry~F. Smith and Hansol Suh and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao Zhang}, title = {{PETSc/TAO} Users Manual}, institution = {Argonne National Laboratory}, number = {ANL-21/39 - Revision 3.22}, doi = {10.2172/2205494}, year = {2024} } % url = {https://petsc.org/release} @TechReport{ petsc-developers, author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, title = {{PETS}c Developers Guide}, institution = {Argonne National Laboratory}, number = {ANL-18/18}, year = {2018}, url = {https://petsc.org/release/developers}, petsc_uses = {KSP} } @Unpublished{ alice-memory-snooper, author = {Ibrahima Ba and Barry~F. Smith}, title = {The {ALICE} Memory Snooper}, year = {1999}, petsc_uses = {KSP} } @TechReport{ petsc-user-ref-polish, author = {Marcin Bojko and Piotr Krzyzanowski}, title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, year = {1998}, note = {An introduction to PETSc in Polish}, petsc_uses = {KSP} } @InProceedings{ abghmn00, title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for High-Performance Scientific Computing}, author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. Norris}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent Hasco\"{e}t and Uwe Naumann}, publisher = {Springer}, year = {2002}, petsc_uses = {KSP} } @Unpublished{ petsc-mpi-paper, author = {Lois Curfman McInnes and Barry F. Smith}, title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software Libraries}, note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, month = jun, year = {1995}, petsc_uses = {KSP} } @InProceedings{ miss-paper, author = {William D. Gropp and Barry F. Smith}, title = {Scalable, Extensible, and Portable Numerical Libraries}, publisher = {IEEE}, year = {1994}, booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, address = {Mississippi State University}, pages = {87--93}, keyword = {numerical libraries, scientific computing, parallel computing}, petsc_uses = {KSP} } @InProceedings{ snes-paper, author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained Minimization Problems}, publisher = {IEEE}, year = {1995}, booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, address = {Mississippi State University}, pages = {60-67}, keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, petsc_uses = {KSP} } @Article{ dsneutral, author = {Barry F. Smith and William D. Gropp}, title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of Sparse Linear Systems}, journal = {Scientific Programming}, volume = {5}, pages = {329--336}, key = {GroppSmith96 ! KSP design}, year = {1996}, petsc_uses = {KSP} } @InProceedings{ bgms98, author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, publisher = {SIAM}, pages = {58-67}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, year = {1998}, petsc_uses = {KSP} } @Article{ hkm98, author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal {PDE} Computation}, journal = {Advances in Engineering Software}, volume = {29}, pages = {415-424}, year = {1998}, petsc_uses = {KSP} } @TechReport{ pdpta99, author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. Smith}, title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, note = {to appear in the Proceedings of the 1999 International Conference on Parallel and Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las Vegas, Nevada}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, number = {ANL/MCS-P751-0599}, year = {1999}, petsc_uses = {KSP} } @InProceedings{ bbh:com, author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific Computing}}, booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International Euro-Par Conference, Munich, Germany, August/September 2000}, year = {2000}, editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, volume = {1900}, series = {Lecture Notes in Computer Science}, pages = {86--94}, address = {Berlin}, publisher = {Springer}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, petsc_uses = {KSP} } @InProceedings{ overture00, author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, title = { {PETSc and Overture}: Lessons Learned Developing an Interface between Components}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, booktitle = {Proceedings of the International Federation for Information Processing Working Conference on Software Architectures for Scientific Computing, Kluwer}, year = {2000}, pages = {57--68}, petsc_uses = {KSP} } @TechReport{ smith97, title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, number = {ANL/MCS-P701}, author = {Barry F. Smith}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, petsc_uses = {KSP} } @Article{ smith98, author = {Barry Smith}, title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, journal = {SIGNUM Newsletter}, year = {1998}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, petsc_uses = {KSP} } @TechReport{ ad-petsc-tm, title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of {PETSc}}, author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, year = {1997}, type = {Technical Memorandum}, institution = {ANL}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, number = {ANL/MCS-TM-233}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Algorithm design and analysis

% LiteralHTML: @PhDThesis{ klotzthesis2019, author = {Thomas S. Klotz}, title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular Biology}, school = {Rice University}, year = {2019}, petsc_uses = {KSP} } @Article{ klotzbardhanknepley2018, title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, journal = {arXiv e-prints}, eprint = {1708.06028}, archiveprefix = {arXiv}, primaryclass = {math.na}, year = {2018}, note = {\url{http://arxiv.org/abs/1708.06028}}, petsc_uses = {KSP} } @Misc{ brown2016, title = {Threading Tradeoffs in Domain Decomposition}, author = {Jed Brown}, note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, year = {2016}, petsc_uses = {KSP} } @Article{ changnakshatralaknepleyjohnsson2017, title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart Johnsson}, journal = {Concurency: Practice and Experience}, volume = {30}, number = {11}, eprint = {1705.03625}, doi = {10.1002/cpe.4401}, year = {2017}, petsc_uses = {KSP} } @Article{ changfabienknepleymills2018, title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} spectrum analysis}, author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, journal = {SIAM Journal on Scientific Computing}, volume = {40}, number = {6}, pages = {C779--C802}, eprint = {1802.07832}, doi = {10.1137/18M1172260}, year = {2018}, petsc_uses = {KSP} } @Article{ joshaghanichangnakshatralaknepley2019, title = {Composable solvers for the four-field double porosity/permeability model}, author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley}, journal = {Journal of Computational Physics}, volume = {386}, pages = {428--466}, doi = {10.1016/j.jcp.2019.02.020}, year = {2019}, petsc_uses = {KSP} } @InProceedings{ barralknepleylangepiggottgorman2016, title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott and Gerard J. Gorman}, booktitle = {25th International Meshing Roundtable}, editor = {Steve Owen and Hang Si}, month = sep, address = {Washington, DC}, pages = {1--5}, url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, year = {2016}, petsc_uses = {KSP} } @Article{ adamsbrownknepleysamtaney2016, title = {Segmental Refinement: A Multigrid Technique for Data Locality}, author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, journal = {SIAM Journal on Scientific Computing}, url = {http://epubs.siam.org/toc/sjoce3/38/4 }, epub = {http://arxiv.org/abs/1406.7808}, volume = {8}, number = {4}, pages = {C426--C440}, doi = {10.1137/140975127}, year = {2016}, petsc_uses = {KSP} } @InProceedings{ maysananruppknepleysmith2016, title = {Extreme-Scale Multigrid Components within {PETSc}}, author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. Smith}, booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, series = {PASC '16}, isbn = {978-1-4503-4126-4}, location = {Lausanne, Switzerland}, pages = {5:1--5:12}, articleno = {5}, numpages = {12}, doi = {10.1145/2929908.2929913}, acmid = {2929913}, publisher = {ACM}, address = {New York, NY, USA}, keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, preconditioning}, year = {2016}, petsc_uses = {KSP} } @Article{ liu2015field, title = {Field-Split Preconditioned Inexact Newton Algorithms}, author = {Lulu Liu and David E Keyes}, journal = {SIAM Journal on Scientific Computing}, volume = {37}, number = {3}, pages = {A1388--A1409}, year = {2015}, publisher = {SIAM}, petsc_uses = {KSP} } @Article{ lujiaomissirlis2014, title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, journal = {Numerical Linear Algebra with Applications}, volume = {21}, number = {2}, pages = {221--238}, year = {2014}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @Article{ badiamartinprincipe2013, title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and solid mechanics}, author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, journal = {International Journal for Numerical Methods in Engineering}, volume = {96}, number = {4}, pages = {203--230}, year = {2013}, petsc_uses = {KSP} } @Article{ morganknepleysananscott2016, title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, journal = {Concurrency and Computation: Practice and Experience}, volume = {28}, pages = {4532--4542}, year = {2016}, url = {http://arxiv.org/abs/1602.04873}, doi = {10.1002/cpe.3820}, petsc_uses = {KSP} } @Article{ morgansananknepleymills2020, title = {Understanding performance variability in standard and pipelined parallel {Krylov} solvers}, author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, journal = {The International Journal of High Performance Computing Applications}, volume = {35}, issue = {1}, doi = {10.1177/1094342020966835}, url = {https://doi.org/10.1177/1094342020966835}, eprint = {https://doi.org/10.1177/1094342020966835}, year = {2020}, petsc_uses = {KSP} } @Article{ msz2013, title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, author = {M. McCourt and B. F. Smith and H. Zhang}, journal = {SIAM Journal on Matrix Analysis and Applications}, year = {2015}, note = {To appear}, petsc_uses = {KSP} } @Article{ bassi2014agglomeration, title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh free}, author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, journal = {Mathematical Models and Methods in Applied Sciences}, volume = {24}, number = {08}, pages = {1495--1539}, year = {2014}, publisher = {World Scientific}, petsc_uses = {KSP} } @Article{ jhuranidemkowicz12, author = {{Jhurani}, C. and {Demkowicz}, L.}, title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. Part II: Algorithms for the Moore-Penrose pseudoinverse}}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {213}, pages = {418-426}, year = {2012}, month = mar, doi = {10.1016/j.cma.2011.06.003}, adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, petsc_uses = {KSP} } @Article{ yangcai11, author = {Yang, Haijian and Cai, Xiao-Chuan}, title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear Complementarity Problems}, journal = {J. Sci. Comput.}, issue_date = {May 2011}, volume = {47}, number = {2}, month = may, pages = {258--280}, year = {2011}, issn = {0885-7474}, numpages = {23}, doi = {10.1007/s10915-010-9436-4}, acmid = {1971246}, publisher = {Plenum Press}, address = {New York, NY, USA}, keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz preconditioners, Semismooth Newton, Two-level methods}, petsc_uses = {KSP} } @Article{ rheinbach09, author = {Rheinbach, Oliver}, title = {Parallel Iterative Substructuring in Structural Mechanics}, journal = {Archives of Computational Methods in Engineering}, volume = {16}, number = {4}, pages = {425-463}, year = {2009}, issn = {1134-3060}, doi = {10.1007/s11831-009-9035-4}, publisher = {Springer Netherlands}, language = {English}, petsc_uses = {KSP} } @Article{ knepleyterrel2013, author = {Matthew G. Knepley and Andy R. Terrel}, title = {Finite Element Integration on {GPUs}}, journal = {{ACM} Transactions on Mathematical Software}, volume = {39}, number = {2}, accepted = {17 April 2012}, year = {2013}, abstract = {We present a novel finite element integration method for low order elements on GPUs. We achieve more than 100GF for element integration on first order discretizations of both the Laplacian and Elasticity operators on an NVIDIA GTX285, which has a nominal single precision peak flop rate of 1 TF/s and bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, url = {http://arxiv.org/abs/1103.0066}, note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, petsc_uses = {KSP} } @Article{ knepleyruppterrel2016, title = {Finite Element Integration with Quadrature on the GPU}, journal = {ArXiv e-prints}, author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, version = {1}, date = {2016-07-14}, eprinttype = {arxiv}, eprintclass = {cs.MS}, eprint = {1607.04245v1}, petsc_uses = {KSP} } @Article{ klawonnlanserrheinbach2014, title = {Nonlinear {FETI-DP} and {BDDC} Methods}, author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, journal = {SIAM Journal on Scientific Computing}, volume = {36}, number = {2}, pages = {A737--A765}, year = {2014}, petsc_uses = {KSP} } @Article{ bruneknepleysmithtu15, title = {Composing Scalable Nonlinear Algebraic Solvers}, author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, journal = {SIAM Review}, volume = {57}, number = {4}, pages = {535--565}, note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, doi = {10.1137/130936725}, year = {2015}, petsc_uses = {KSP} } @Article{ mszm2014, title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, volume = {40}, pages = {17--31}, year = {2014}, journal = {Parallel Computing}, doi = {10.1016/j.parco.2013.10.001}, petsc_uses = {KSP} } @TechReport{ mszm2012, title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, year = {2012}, number = {ANL/MCS-P2097-0512}, institution = {Argonne National Laboratory}, petsc_uses = {KSP} } @InProceedings{ bkmms2012, author = {Jed Brown and Matthew Knepley and David A. May and Lois C. McInnes and Barry F. Smith}, title = {Composable linear solvers for multiphysics}, booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed Computing} ({ISPDC} 2012)}, year = {2012}, doi = {10.1109/ISPDC.2012.16}, publisher = {IEEE Computer Society}, pages = {55--62}, petsc_uses = {KSP} } @Article{ bourdinbucuroudet2009, author = {Blaise Bourdin and D. Bucur and E. Oudet}, title = {Optimal Partitions for Eigenvalues}, journal = {SIAM J. Sci. Comput.}, volume = {31}, number = {6}, pages = {4100--4114}, year = {2009}, petsc_uses = {KSP} } @InBook{ kimnbourdin2007, author = {J.-H. Kimn and Blaise Bourdin}, title = {Numerical implementation of overlapping balancing domain decomposition methods on unstructured meshes}, editor = {O. B. Widlund and D. E. Keyes}, booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, series = {Lecture Notes in Computational Science and Engineering}, number = {55}, publisher = {Springer-Verlag}, pages = {309--315}, url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, year = {2007}, petsc_uses = {KSP} } @Article{ bjm2005, author = {AH Baker and ER Jessup and T Manteuffel}, title = {A Technique for Accelerating the Convergence of Restarted GMRES}, journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, year = {2005}, petsc_uses = {KSP} } @Unpublished{ sundar-2008a, author = {R.S. Sampath and G. Biros}, title = {A parallel geometric multigrid method for finite elements on octree meshes}, url = {http://www.seas.upenn.edu/\~{ }rahulss}, petsc_uses = {KSP} } @Article{ sundar-2008, author = {H. Sundar and R.S. Sampath and G. Biros}, title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, journal = {SIAM Journal on Scientific Computing}, year = {2008}, url = {http://www.seas.upenn.edu/\~{ }rahulss}, petsc_uses = {KSP} } @InProceedings{ sundar-2007, author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, title = {Low-constant parallel algorithms for finite element simulations using linear octrees}, booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, year = {2007}, url = {http://www.seas.upenn.edu/\~{ }rahulss}, petsc_uses = {KSP} } @InProceedings{ adams-98a, author = {Adams, Mark ~F.}, title = {A Parallel Maximal Independent Set Algorithm}, booktitle = {Proceedings 5th copper mountain conference on iterative methods}, year = {1998}, petsc_uses = {KSP} } @Article{ akcelik2005ddd, title = {{Dynamic data-driven inversion for terascale simulations: real-time identification of airborne contaminants}}, author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and van Bloemen Waanders, B.}, journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, year = {2005}, publisher = {IEEE Computer Society Washington, DC, USA}, petsc_uses = {KSP} } @InBook{ akcelik-2006, author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van Bloemen Waanders}, bookeditor = {M. Heroux and P. Raghaven and H. Simon}, title = {Frontiers of Parallel Computing}, chapter = {Parallel algorithms for {PDE}-constrained optimization}, publisher = {SIAM}, year = {2006}, petsc_uses = {KSP} } @Article{ dt, author = {Matthew F. Dixon and C. J. Kenneth Tan}, title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional Convection Diffusion Equations}, journal = {The Journal of Supercomputing}, year = {2004}, pages = {235--253}, volume = {28}, url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, petsc_uses = {KSP} } @PhDThesis{ hwang2004, author = {Feng-Nan Hwang}, title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in Computational Fluid Dynamics}, school = {University of Colorado at Boulder}, year = {2004}, petsc_uses = {KSP} } @PhDThesis{ baker, author = {{A. H.} Baker}, title = {On improving the performance of the linear solver restarted {GMRES}}, school = {University of Colorado at Boulder}, year = {2003}, petsc_uses = {KSP} } @TechReport{ klawonnrheinbach601, author = {Axel Klawonn and Oliver Rheinbach}, title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional Linear Elasticity Using a Transformation of Basis}, institution = {Universit\"at Duisburg-Essen}, year = {2005}, type = {Technical Report}, number = {SM-E-601}, petsc_uses = {KSP} } @TechReport{ klawonnrheinbach609, author = {Axel Klawonn and Oliver Rheinbach}, title = {Inexact FETI-DP Methods}, institution = {Universit\"at Duisburg-Essen}, year = {2005}, type = {Technical Report}, number = {SM-E-609}, petsc_uses = {KSP} } @TechReport{ klawonnrheinbach607, author = {Axel Klawonn and Oliver Rheinbach}, title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, institution = {Universit\"at Duisburg-Essen}, year = {2005}, type = {Technical Report}, number = {SM-E-607}, petsc_uses = {KSP} } @Article{ kul-natraj-pbp, author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, title = {Performance of a parallel mixed finite element implementation for fourth order clamped anisotropic plate bending problems in distributed memory environments}, journal = {Applied Mathematics and Computation}, volume = {155}, year = {2004}, number = {3}, pages = {753--777}, petsc_uses = {KSP} } @Article{ bramkamp2006uej, author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, journal = {Computers \& Fluids}, volume = {35}, number = {10}, pages = {1063--1073}, doi = {10.1016/j.compfluid.2005.10.003}, abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the derivation of the analytic flux Jacobian can become quite complicated depending on the complexity of the numerical flux calculation. Practically, the derivation of the exact Jacobian by hand is an unrealistic option because of the enormous man-hour investment needed. In this work, automatic differentiation is used to evaluate the exact Jacobian of upwind schemes implemented in the flow solver QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically approximated by first-order forward differences. For a two-dimensional airfoil under three different flight conditions (quasi-incompressible flow, compressible subsonic flow, and transonic flow), we show that the robustness and performance of the present finite volume scheme is significantly improved by using exact Jacobians.}, year = {2006}, petsc_uses = {KSP} } @Article{ shahbazi1, author = {Khosro Shahbazi}, title = {An explicit expression for the penalty parameter of the interior penalty method}, journal = {Journal of Computational Physics}, volume = {205}, year = {2005}, pages = {401--407}, petsc_uses = {KSP} } @TechReport{ kk, title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, author = {Hans-Peter Kersken and Uwe Kuster}, year = {1999}, institution = {University of Stuttgart}, url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, number = {310}, petsc_uses = {KSP} } @Article{ miha-mija, author = {M. D. Mihajlovi and S. Mijalkovi}, title = {A component decomposition preconditioning for 3D stress analysis problems}, journal = {Numerical Linear Algebra with Applications}, volume = {9}, year = {2002}, pages = {567--583}, url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, petsc_uses = {KSP} } @Article{ bjm, author = {M Benzi and W Joubert and G Mateescu}, journal = {Electronic Transactions on Numerical Analysis}, year = {1999}, volume = {8}, pages = {88--114}, title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, petsc_uses = {KSP} } @PhDThesis{ hyde, author = {EMK Hyde}, title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, school = {Caltech}, year = {2003}, url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, petsc_uses = {KSP} } @Article{ km2003, author = {A. Keese and H. G. Matthies}, journal = {Proceedings in Applied Mathematics and Mechanics}, year = {2003}, volume = {2}, pages = {485--486}, title = {Parallel Solution of Stochastic PDEs}, url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, petsc_uses = {KSP} } @Article{ whszss, author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld and Otmar Scherzer and H. Siegfried Stiehl}, journal = {Real Time Imaging}, year = {2001}, volume = {7}, pages = {31--45}, title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion approaches}, url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, petsc_uses = {KSP} } @TechReport{ baker1, title = {An Efficient Block Variant of GMRES}, author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, year = {2003}, type = {Technical Report}, institution = {University of Colorado, Boulder}, url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, number = {CU-CS-957-03}, petsc_uses = {KSP} } @InProceedings{ mc2003, author = {Leszek Marcinkowski and Xiao-Chuan Cai}, title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, booktitle = {Proceedings of the 15th International Conference on Domain Decomposition Methods}, pages = {639--646}, publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, note = {}, url = {http://www.ddm.org/DD15/proceedings-dd15.html}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ kt2003, author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, booktitle = {Proceedings of the 15th International Conference on Domain Decomposition Methods}, pages = {615--622}, publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, note = {}, url = {http://www.ddm.org/DD15/proceedings-dd15.html}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ krw2003, author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 3D}, booktitle = {Proceedings of the 15th International Conference on Domain Decomposition Methods}, pages = {361--368}, publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, note = {}, url = {http://www.ddm.org/DD15/proceedings-dd15.html}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ hc2003, author = {Feng-Nan Hwang and Xiao-Chuan Cai}, title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through Nonlinear Preconditioning}, booktitle = {Proceedings of the 15th International Conference on Domain Decomposition Methods}, pages = {201--208}, publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, note = {}, url = {http://www.ddm.org/DD15/proceedings-dd15.html}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ g2003, author = {P. Goldfeld}, title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and (Generalized) {Stokes} and Parallel Implementation}, booktitle = {Proceedings of the 14th International Conference on Domain Decomposition Methods}, pages = {209--216}, editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, publisher = {National Autonomous University of Mexico (UNAM)}, note = {}, url = {http://www.ddm.org/DD14}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ dhv2003, author = {Zdenek Dostal and David Horak and Oldrich Vlach}, title = {Toward scalable {FETI} algorithm for variational inequalities with applications to composites}, booktitle = {Proceedings of the 14th International Conference on Domain Decomposition Methods}, pages = {395--401}, editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, publisher = {National Autonomous University of Mexico (UNAM)}, note = {}, url = {http://www.ddm.org/DD14}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ dhsv2002, author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, title = {Scalabilities of {FETI} for variational inequalities and contact shape optimization}, booktitle = {Proceedings of the 13th International Conference on Domain Decomposition Methods}, pages = {359--367}, editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, publisher = {CIMNE, Barcelona, Spain}, note = {}, url = {http://www.ddm.org/DD13}, year = {2002}, petsc_uses = {KSP} } @InProceedings{ cky2002, author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked Duct Flows}, booktitle = {Proceedings of the 13th International Conference on Domain Decomposition Methods}, pages = {343--350}, editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, publisher = {CIMNE, Barcelona, Spain}, note = {}, url = {http://www.ddm.org/DD13}, year = {2002}, petsc_uses = {KSP} } @Conference{ li-etal:03, author = {Li, Z. and Lanteri S. and Saad, Y.}, title = {Multiplicative-additive preconditioning combination for general sparse linear systems}, booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse Matrix Problems in Scientific and Industrial Applications}, address = {Napa, California, USA}, date = {october 27-29}, year = {2003}, petsc_uses = {KSP} } @Article{ bashir2008hessian, title = {Hessian-based model reduction for large-scale systems with initial-condition inputs}, author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, J.}, journal = {International journal for numerical methods in engineering}, volume = {73}, number = {6}, pages = {844--868}, year = {2008}, publisher = {Wiley Online Library}, petsc_uses = {KSP} } @Article{ bashir2007hessian, title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, K.}, journal = {Computational Science--ICCS 2007}, pages = {1010--1017}, year = {2007}, publisher = {Springer}, petsc_uses = {KSP} } @Article{ akcelik2011fast, title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear inverse problems based on low-rank partial {H}essian approximations}, author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Wilcox, L.}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {1}, year = {2011}, petsc_uses = {KSP} } @InProceedings{ ff2003, author = {Abul K. M. Fahimuddin and Heike Fassbender}, title = {Model Reduction for Large Scale Applications in Microsystem Technology}, booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ d2b2004, author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different Ordering Strategies}, booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, year = {2004}, petsc_uses = {KSP} } @InProceedings{ d2v2005, author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid Flow Equations}, booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, year = {2005}, petsc_uses = {KSP} } @InProceedings{ dvs2006, author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit Mixed Convection Equations}, booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, year = {2006}, petsc_uses = {KSP} } @Article{ dsv2006, author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid Flow Equations}, journal = {Computational Fluid Dynamics}, year = {2006}, volume = {15}, number = {1}, petsc_uses = {KSP} } @Article{ lahaye03, author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, journal = {J. Comput. Appl. Math.}, year = {2004}, pages = {267--275}, volume = {168}, petsc_uses = {KSP} } @TechReport{ brmn, title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, year = {2002}, type = {Technical Report}, institution = {ANL}, number = {ANL/MCS-P993-0902}, note = {To appear in Future Generation Computer Systems}, petsc_uses = {KSP} } @InProceedings{ mnbr, author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} Algorithms}, booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid Mechanics}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ bmnr, author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, booktitle = {Proceedings of the 2003 International Conference on Computational Science and its Applications, Lecture notes in Computer Science 2677}, editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, pages = {828--839}, year = {2003}, petsc_uses = {KSP} } @Article{ ph03, author = {M. Pernice and R. D. Hornung}, title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, journal = {Computing and Visualization in Science}, year = {2003}, lab = {LANL}, petsc_uses = {KSP} } @Article{ adams-02, author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, journal = {J. Comp. Phys.}, number = {2}, pages = {593-610}, title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, volume = {188}, year = {2003}, petsc_uses = {KSP} } @InProceedings{ adams2001distributed, title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid smoothers}, author = {Adams, M.F.}, booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, pages = {14--14}, year = {2001}, organization = {IEEE}, petsc_uses = {KSP} } @PhDThesis{ els01, author = {Ulrich Elsner}, title = {Static and Dynamic Graph Partitioning. A comparative study of existing algorithms}, school = {Technical University Chemnitz}, year = {2002}, publisher = {Logos Verlag, Berlin}, isbn = {3-89722-923-4}, annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare different graph partitioning algorithms}, petsc_uses = {KSP} } @TechReport{ ckk02, title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, year = {2002}, type = {Technical Report}, institution = {ODU}, url = {http://www.math.odu.edu/\~{ }keyes}, note = {Submitted to the special issue of the SIAM Journal of Scientific Computing dedicated to papers from the 2002 Copper Mountain Conference on Iterative Methods}, petsc_uses = {KSP} } @Article{ gpw2002, title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of Heterogeneous Problems in Linear Elasticity}, author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, year = {2003}, pages = {283--324}, volume = {95}, url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, journal = {Numerische Mathematik}, petsc_uses = {KSP} } @Article{ dh1, title = {Scalability and FETI based algorithm for large discretized variational inequalities}, author = {Z Dostal and D Horak}, year = {2003}, pages = {347--357}, volume = {61}, url = {http://portal.acm.org/citation.cfm?id=770222.770239}, journal = {Mathematics and Computers in Simulation}, petsc_uses = {KSP} } @InProceedings{ dhsv1, author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape Optimization}, booktitle = {Proceedings of the 13th International Conference on Domain Decomposition Methods}, editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. Kuznetsov}, petsc_uses = {KSP} } @Article{ lahaye02, author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, journal = {IEEEMAGN}, year = {2002}, volume = {38}, number = {2}, pages = {413-416}, petsc_uses = {KSP} } @Article{ ckm01, author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, title = {Nonlinear additive {Schwarz} preconditioners and applications in computational fluid dynamics}, journal = {International Journal of Numerical Methods in Fluid Mechanics}, year = {2002}, volume = {40}, pages = {1463--1470}, petsc_uses = {KSP} } @InProceedings{ cky01, author = {X.-C. Cai and D. E. Keyes and D. P. Young}, url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked duct flow}, booktitle = {Proceedings of the 13th International Conference on Domain Decomposition Methods}, editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. Kuznetsov}, year = {2002}, petsc_uses = {KSP} } @Article{ ck02, author = {X.-C. Cai and D. E. Keyes}, url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, title = {Nonlinearly preconditioned inexact {Newton} algorithms}, journal = {SIAM J. Sci. Comput.}, year = {2002}, pages = {183--200}, volume = {24}, petsc_uses = {KSP} } @Article{ c04, author = {Feng-Nan Hwang and X.-C. Cai}, url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm for incompressible {Navier-Stokes} equations}, journal = {Journal of Computational Physics}, year = {2005}, volume = {204}, pages = {666--691}, petsc_uses = {KSP} } @Article{ hc06, author = {Feng-Nan Hwang and X.-C. Cai}, url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} Algorithms}, journal = {Computer Methods in Applied Mechanics and Engineering}, year = {2006}, volume = {196}, pages = {1603--1611}, petsc_uses = {KSP} } @InProceedings{ adams-01, author = {Mark F. Adams}, title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid Smoothers}, booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, address = {Denver, Colorado}, month = nov, year = {2001}, petsc_uses = {KSP} } @Book{ 1dl, author = {Domenico Lahaye}, title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field Computations}, year = {2001}, publisher = {Katholieke Universiteit Leuven}, notes = {Thesis}, petsc_uses = {KSP} } @Article{ adams-00, author = {Adams, M.~F.}, journal = {International Journal for Numerical Methods in Engineering}, number = {8}, pages = {1241-1262}, title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large Deformation Elasticity and Plasticity}, volume = {48}, year = {2000}, petsc_uses = {KSP} } @Article{ adams2002evaluation, author = {Adams, M.~F.}, journal = {International Journal for Numerical Methods in Engineering}, number = {1}, pages = {519-534}, title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element Problems in Solid Mechanics}, volume = {55}, year = {2002}, petsc_uses = {KSP} } @Article{ lahaye00, author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, title = {Algebraic Multigrid for Complex Symmetric Systems}, journal = {IEEEMAGN}, year = {2000}, volume = {36}, number = {4}, pages = {1535--1538}, petsc_uses = {KSP} } @InProceedings{ adams-99c, author = {Mark F. Adams and J. Demmel}, title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured Finite Element Problems}, booktitle = {Proceedings of SC99: High Performance Networking and Computing}, address = {Portland, Oregon}, month = nov, year = {1999}, petsc_uses = {KSP} } @Article{ chan95, author = {T. Chan and B. Smith and J. Zou}, title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse Grids}, journal = {Numer. Math.}, year = {1995}, volume = {73}, pages = {149--167}, petsc_uses = {KSP} } @TechReport{ adams-csd-98-993, pages = {11}, year = {1998}, type = {Technical Report}, number = {CSD-98-993}, institution = {University of California, Berkeley}, title = {A Parallel Maximal Independent Set Algorithm}, bibdate = {March 11, 1998}, author = {Mark F. Adams and James Demmel}, abstract = {The parallel construction of maximal independent sets is a useful building block for many algorithms in the computational sciences, including graph coloring and multigrid coarse grid creation on unstructured meshes. We present an efficient asynchronous maximal independent set algorithm for use on parallel computers, for ``well partitioned'' graphs, that arise from finite element (FE) models. For appropriately partitioned bounded degree graphs, it is shown that the running time of our algorithm under the P-RAM computational model is of $O(1)$, which is an improvement over the previous best P-RAM complexity for this class of graphs. We present numerical experiments on an IBM SP, that confirm our P-RAM complexity model is indicative of the performance one can expect with practical partitions on graphs from FE problems.}, month = mar, petsc_uses = {KSP} } @Article{ benzigolubliesen2005, title = {Numerical solution of saddle point problems}, author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, volume = {14}, journal = {Acta Numerica}, pages = {1-–137}, doi = {10.1017/S0962492904000212}, year = {2005} } @Article{ mardal2011preconditioning, title = {Preconditioning discretizations of systems of partial differential equations}, author = {Kent-Andre Mardal and Ragnar Winther}, journal = {Numerical Linear Algebra with Applications}, volume = {18}, number = {1}, pages = {1--40}, year = {2011} } @TechReport{ k676, year = {1994}, type = {Technical Report}, number = {TR1994-676}, institution = {New York University}, title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty Term}, author = {Axel Klawonn}, url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, petsc_uses = {KSP} } @Book{ ak1, author = {Axel Klawonn}, title = {Preconditioners for Indefinite Problems}, year = {1995}, publisher = {Westfalishen Wilhelms-Universitat Munster}, url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, notes = {Thesis}, petsc_uses = {KSP} } @TechReport{ knepleykarpeev05, pages = {41}, year = {2005}, type = {Technical Report}, number = {ANL/MCS-P1295-1005}, institution = {Argonne National Laboratory}, title = {Flexible Representation of Computational Meshes}, author = {Matthew G. Knepley and Dmitry A. Karpeev}, abstract = {}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, month = oct, petsc_uses = {DMPlex} } @TechReport{ knepleykarpeev07a, pages = {14}, year = {2007}, type = {Technical Report}, number = {ANL/MCS-P1455-0907}, institution = {Argonne National Laboratory}, title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, author = {Matthew G. Knepley and Dmitry A. Karpeev}, abstract = {}, url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, month = feb, petsc_uses = {DMPlex} } @Article{ knepleykarpeev09, author = {Matthew G. Knepley and Dmitry A. Karpeev}, title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, journal = {Scientific Programming}, volume = {17}, number = {3}, pages = {215--230}, year = {2009}, doi = {10.3233/SPR-2009-0249}, url = {http://arxiv.org/abs/0908.4427}, note = {\url{http://arxiv.org/abs/0908.4427}}, petsc_uses = {DMPlex} } @Article{ biezuner2012computing, author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of Sublinear Supersolutions}, journal = {Journal of Scientific Computing}, publisher = {Springer Netherlands}, issn = {0885-7474}, keyword = {Mathematics and Statistics}, pages = {180--201}, volume = {52}, issue = {1}, year = {2012}, doi = {10.1007/s10915-011-9540-0}, petsc_uses = {KSP} } % LiteralHTML: % LiteralHTML:

Books

% LiteralHTML: @Book{ knepley2017, title = {Computational Science I}, author = {Matthew G. Knepley}, url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, publisher = {PETSc}, year = {2017}, petsc_uses = {KSP} } @Article{ verleyeuser, title = {{User friendly permeability predicting software for technical textiles}}, author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and Roose, D.}, journal = {status: published}, issn = {1560-6074}, publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, petsc_uses = {KSP} } @Book{ pacheco, author = {Peter Pacheco}, title = {Parallel Programming with MPI}, year = {1997}, publisher = {Morgan-Kaufmann}, note = {Devotes a couple of sections to PETSc}, petsc_uses = {KSP} } @Book{ 1sbg, author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial Differential Equations}, year = {1996}, publisher = {Cambridge University Press}, url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, petsc_uses = {KSP} } @Misc{ petsc-fem:homepage, title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and G. Rodriguez and G. Filippini}, howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, petsc_uses = {KSP} } @Misc{ petsc4py-web-page, author = {Lisandro Dalcin}, title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, howpublished = {\url{http://code.google.com/p/petsc4py/}}, note = {http://code.google.com/p/petsc4py/}, petsc_uses = {KSP} } @Article{ libmeshpaper06, author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening Simulations}}, journal = {Engineering with Computers}, volume = {22}, number = {3--4}, pages = {237--254}, year = {2006}, doi = {10.1007/s00366-006-0049-3}, petsc_uses = {KSP} } @Misc{ sisiphus:homepage, title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, High-Resolution, Unstructured Simulations}, author = {T. {Tautges et al.}}, howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, petsc_uses = {KSP} } @Misc{ pflotran:homepage, title = {{PFLOTRAN} project}, author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra and Jitendra Kumar and Peter Lichtner and Richard Mills}, howpublished = {\url{http://pflotran.org/}}, petsc_uses = {KSP} } @Misc{ pism:homepage, title = {{PISM}: A Parallel Ice Sheet Model}, author = {E. {Bueler et al.}}, howpublished = {\url{http://pism-docs.org}}, petsc_uses = {KSP} } @Misc{ dohp:homepage, title = {Dohp: Dual order $hp$-finite elements}, author = {J. Brown}, howpublished = {\url{http://dohp.org}}, petsc_uses = {KSP} } @Article{ mccourtrognlienetal12, title = {Improving parallel scalability for edge plasma transport simulations with neutral gas species}, author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, journal = {Computational Science and Discovery}, year = {2012}, volume = {5}, number = {014012}, doi = {10.1088/1749-4699/5/1/014012}, note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 2011)}, petsc_uses = {KSP} } @Misc{ petclaw-github, title = {Pet{C}law Software}, author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, year = {2011}, howpublished = {\url{https://github.com/pyclaw/pyclaw}}, petsc_uses = {KSP} } @Misc{ pyclaw-web-page, author = {Kyle T. Mandli and David I. Ketcheson and others}, title = {{PyClaw} software}, howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, url = {http://clawpack.github.io/doc/pyclaw/}, year = {2012}, petsc_uses = {KSP} } @Article{ ketcheson2011highorder, title = {High-order wave propagation algorithms for general hyperbolic systems}, author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, year = {2011}, note = {submitted}, petsc_uses = {KSP} } @Article{ biros2005pln1, title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained optimization. Part I: The {Krylov-Schur} solver}}, author = {Biros, G. and Ghattas, O.}, journal = {SIAM Journal on Scientific Computing}, volume = {27}, number = {2}, pages = {687--713}, year = {2005}, publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, petsc_uses = {KSP} } @Article{ biros2005pln2, title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained optimization. Part {II}: The {Lagrange Newton} solver, and its application to optimal control of steady viscous flows}, author = {Biros, G. and Ghattas, O.}, journal = {SIAM Journal on Scientific Computing}, volume = {27}, number = {2}, pages = {714--739}, year = {2005}, publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, petsc_uses = {KSP} } @Misc{ issm:homepage, title = {{I}ce {S}heet {S}ystem {M}odel}, author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, year = {2010}, note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, petsc_uses = {KSP} } @Article{ morlighem2010spatial, title = {Spatial patterns of basal drag inferred using control methods from a full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est {A}ntarctica}, author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and Aubry, D.}, journal = {Geophysical Research Letters}, volume = {37}, number = {14}, pages = {L14502}, year = {2010}, publisher = {American Geophysical Union}, petsc_uses = {KSP} } @Article{ jardin2012plasmas, title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics of tokamak plasmas}, author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, journal = {Computational Science \& Discovery}, volume = {5}, number = {1}, url = {http://stacks.iop.org/1749-4699/5/014002}, year = {2012}, petsc_uses = {KSP} } @Article{ cmz2016, title = {Analysis and Practical Use of Flexible {BiCGStab}}, author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, journal = {Journal of Scientific Computing}, publisher = {Springer}, pages = {803--825}, volume = {68}, issue = {2}, url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, doi = {10.1007/s10915-015-0159-4}, year = {2016}, note = {Also preprint ANL/MCS-P3039-0912}, petsc_uses = {KSP} } @Article{ knepleybrownruppsmith13, author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, title = {Achieving High Performance with Unified Residual Evaluation}, journal = {ArXiv e-prints}, eprint = {1309.1204}, archiveprefix = {arXiv}, primaryclass = {cs.MS}, keywords = {Computer Science - Mathematical Software, Computer Science - Computational Engineering, Finance, and Science}, year = {2013}, month = sep, adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, adsnote = {Provided by the SAO/NASA Astrophysics Data System}, petsc_uses = {KSP} } @Book{ fenicsbook, title = {Automated Solution of Differential Equations by the Finite Element Method: The FEniCS Book}, series = {Lecture Notes in Computational Science and Engineering}, volume = {84}, editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, publisher = {Springer}, isbn = {978-3-642-23098-1}, year = {2012}, petsc_uses = {KSP} } @Article{ demidovahnertruppgottschling12, author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, journal = {ArXiv e-prints}, archiveprefix = {arXiv}, eprint = {1212.6326}, primaryclass = {cs.MS}, keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, Parallel, and Cluster Computing, Physics - Computational Physics}, year = {2012}, month = dec, adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, adsnote = {Provided by the SAO/NASA Astrophysics Data System}, petsc_uses = {KSP} } @InProceedings{ viennacl, author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, year = {2010}, pages = {51-56}, petsc_uses = {KSP} } @Article{ knepleybrownmcinnessmithruppadams2015, title = {Exascale Computing without Threads}, author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and Karl Rupp and Mark Adams}, url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on Scientific Software Architecture for Portability and Performance}, doi = {10.6084/m9.figshare.5824950.v1}, year = {2015}, petsc_uses = {KSP} } @Article{ knepleybrownmcinnessmithruppadams2015b, title = {Overview of the {PETSc} Library}, author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and Karl Rupp and Mark Adams}, url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on Scientific Software Architecture for Portability and Performance}, year = {2015}, petsc_uses = {KSP} } @InCollection{ balaybrownknepleymcinnessmith2015, author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry Smith}, title = {Providing Mixed Language and Legacy Support within a Library}, editor = {J. Carver}, booktitle = {Software Engineering for Science}, publisher = {Taylor \& Francis}, year = {2015}, petsc_uses = {KSP} } @Article{ ruppbalaybrownknepleymcinnessmith2015, title = {On The Evolution Of User Support Topics in Computational Science and Engineering Software}, author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman McInnes and Barry F. Smith}, note = {Whitepaper for Computational Science \& Engineering Software Sustainability and Productivity Challenges}, journal = {ArXiv e-prints}, archiveprefix = {arXiv}, eprint = {1510.01122}, year = {2015}, petsc_uses = {KSP} } @InProceedings{ knepley2013accurately, title = {Accurately Citing Software and Algorithms Used in Publications}, author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry F.}, year = {2013}, booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences (WSSSPE), held at SC13}, doi = {10.6084/m9.figshare.785731}, petsc_uses = {KSP} } @InProceedings{ milleretal2013, title = {Package Management Practice Essential for Interoperability: Lessons Learned and Strategies Developed for {FASTMath}}, author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and Barry Smith}, year = {2013}, booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences (WSSSPE), held at SC13}, doi = {10.6084/m9.figshare.789055}, petsc_uses = {KSP} } @TechReport{ dudsonetal2012, title = {Improved Nonlinear Solvers in {BOUT++}}, author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, institution = {Argonne National Laboratory}, number = {ANL/MCS-P3025-0812}, year = {2012}, petsc_uses = {KSP} } @Misc{ brown13, author = {J. Brown}, title = {Scalable Repository Workflows}, note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, year = {2013}, petsc_uses = {KSP} } @Misc{ starforest11, title = {Star forests as a parallel communication model}, author = {Jed Brown}, url = {https://jedbrown.org/files/StarForest.pdf}, year = {2011}, petsc_uses = {KSP} } @Misc{ brownknepleysmith13, author = {J. Brown and M. Knepley and B. Smith}, title = {Run-time Extensibility: Anything Less is Unsustainable}, note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, year = {2013}, petsc_uses = {KSP} } @Article{ jzhaoyliwkliu15, author = {J. Zhao and Y. Li and W.K. Liu}, title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry via {XFEM}}, journal = {Computational Mechanics}, year = {2015}, url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, petsc_uses = {KSP} } @Article{ alisic14, author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, title = {Compaction around a rigid, circular inclusion in partially molten rock}, journal = {J. Geophys. Res.}, year = {2014}, volume = {119}, number = {7}, pages = {5903-5920}, doi = {10.1002/2013JB010906}, petsc_uses = {KSP} } @Article{ rhebergen14, author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, journal = {SIAM J. Sci. Comp.}, year = {2014}, volume = {36}, number = {4}, pages = {1960-1977}, doi = {10.1137/130946678}, petsc_uses = {KSP} } @Article{ allwright14, author = {J. Allwright and R.F. Katz}, title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, journal = {Geophys. J. Int.}, year = {2014}, volume = {199}, number = {3}, pages = {1608--1624}, doi = {10.1093/gji/ggu345}, petsc_uses = {KSP} } @Misc{ gropp10, author = {William D. Gropp}, title = {Update on libraries for {B}lue {W}aters}, address = {Bordeaux, France}, year = {2010}, url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, petsc_uses = {KSP} } @InProceedings{ mayknepley2017, title = {{DMSwarm}: Particles in {PETSc}}, author = {Dave A May and Matthew G Knepley}, booktitle = {EGU General Assembly Conference Abstracts}, volume = {19}, pages = {10133}, year = {2017}, petsc_uses = {KSP} } @InProceedings{ adamsbrownknepley2013, author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, title = {Low-communication techniques for extreme-scale multilevel solvers}, booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, organization = {DOE Office of Advanced Scientific Computing Research}, year = {2013}, petsc_uses = {KSP} } @Article{ bhallagriffithknepleyadamsguy2017, title = {Scalable smoothing strategies for a geometric multigrid method for the immersed boundary equations}, author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. Adams and Robert D. Guy}, journal = {arXiv e-prints}, eprint = {1612.02208}, year = {2017}, note = {\url{http://arxiv.org/abs/1612.02208}}, petsc_uses = {KSP} } @Article{ zampini2016pcbddc, title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, author = {Zampini, Stefano}, journal = {SIAM Journal on Scientific Computing}, volume = {38}, number = {5}, pages = {S282--S306}, year = {2016}, publisher = {SIAM}, petsc_uses = {KSP} } @Article{ jolivetromanzampini2020, title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and robust multilevel overlapping {Schwarz} preconditioners}, author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, journal = {Computers and Mathematics with Applications}, volume = {84}, pages = {277--295}, year = {2021} } @Article{ zampinitu2017, title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in porous media}, author = {Stefano Zampini and Xuemin Tu}, journal = {SIAM Journal of Scientific Computing}, volume = {39}, number = {4}, pages = {A1389--A1415}, year = {2017} } @Article{ ohwidlundzampinidohrmann2017, title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal constraints for {Raviart-Thomas} vector fields}, author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, journal = {Mathematics of Computation}, volume = {87}, number = {310}, pages = {659--692}, year = {2017} } @Article{ veigapavarinoscacchiwidlundzampini2016, title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe preconditioners}, author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, journal = {SIAM Journal of Scientific Computing}, volume = {39}, number = {1}, pages = {A281--A302}, year = {2016} } @Article{ pavarinoscacchiwidlundzampini2018, title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric analysis}, author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, journal = {Mathematical Models and Methods in Applied Sciences}, volume = {28}, number = {7}, pages = {1337--1370}, year = {2018} } @Article{ bergervergiatwaisman2017, title = {An overlapping Domain Decomposition preconditioning method for monolithic solution of shear bands}, author = {Luc Berger-Vergiat and Haim Waisman}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {318}, pages = {33--60}, year = {2017}, petsc_uses = {KSP} } @Article{ abhyankarmaldonadosmithzhang2020, title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics Simulations}, author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and H. Zhang}, journal = {ACM Transactions on Mathematical Software}, volume = {46}, number = {1}, year = {2020}, doi = {10.1145/3344587}, petsc_uses = {KSP} } @InProceedings{ zhangellpack2018, author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using {AVX-512}}, booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, year = {2018}, petsc_uses = {KSP} } @Misc{ petsc-user-meetings:website, title = {{PETSc User Meetings}}, key = {PETSc User Meetings}, howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, petsc_uses = {KSP} } @Article{ flexible-bicgstab-chen16, title = {Analysis and Practical Use of Flexible {BiCGStab}}, author = {J. Chen and L.C. McInnes and H. Zhang}, journal = {Journal of Scientific Computing}, volume = {68}, number = {2}, month = jul, year = {2016}, pages = {803--825}, doi = {10.1007/s10915-015-0159-4}, petsc_uses = {KSP} } @Misc{ petsc-extensibility2016, author = {M. Knepley and D. A. May and J. Brown and B. Smith}, title = {{Extensibility in PETSc}}, note = {SIAM News, available via \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, year = {2016}, petsc_uses = {KSP} } @Misc{ error-estimation-whitepaper2017, author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, title = {End-to-end error estimation and control}, note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, doi = {10.6084/m9.figshare.5339866}, year = {2017}, petsc_uses = {KSP} } @Misc{ petsc-user-support15, title = {On the Evolution of User Support Topics in Computational Science and Engineering Software}, author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 15-16, 2015}, year = {2015}, petsc_uses = {KSP} } @InBook{ petsc-mixed-language-support2016, title = {Numerical Library Support for High-Performance Mixed Language Applications and Legacy Code}, author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, booktitle = {Software Engineering for Science}, editors = {J. Carver et al.}, publisher = {CRC Press}, pages = {201--214}, year = {2016}, petsc_uses = {KSP} } @InProceedings{ konolige2018parallel, title = {A Parallel Solver for Graph {L}aplacians}, author = {Tristan Konolige and Jed Brown}, booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, doi = {10.1145/3218176.3218227}, note = {Best Paper Award}, archiveprefix = {arXiv}, eprint = {1705.06266}, year = {2018}, petsc_uses = {KSP} } @InProceedings{ werner-kimn2019, title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal power flow using high-performance computing}, author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and Jung-Han Kimn}, booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, note = {Best Paper in Track}, year = {2019}, petsc_uses = {KSP} } @MastersThesis{ rinaldo-ceresoli18, author = {Stefano Guido Rinaldo and Andrea Ceresoli}, title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related Applications}, school = {Politecnico di Milano}, year = {2018}, month = apr, petsc_uses = {KSP} } @Article{ sananschneppmay2016, title = {Pipelined, Flexible {K}rylov Subspace Methods}, author = {P. Sanan and S. M. Schnepp and D. A. May}, journal = {SIAM Journal on Scientific Computing}, volume = {38}, number = {5}, pages = {C441-C470}, year = {2016}, doi = {10.1137/15M1049130}, petsc_uses = {KSP} } @Article{ petscsf2022, author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and Smith, Barry F. and Zampini, Stefano}, journal = {IEEE Transactions on Parallel and Distributed Systems}, title = {The {PetscSF} Scalable Communication Layer}, year = {2022}, volume = {33}, number = {4}, pages = {842-853}, doi = {10.1109/TPDS.2021.3084070} } @Article{ brandt2000, title = {General highly accurate algebraic coarsening}, author = {Achi Brandt}, journal = {Electronic Transactions on Numerical Analysis}, volume = {10}, number = {9680}, pages = {1--20}, issn = {10689613}, year = {2000} } @Article{ dalcinpazklercosimo2011, title = {Parallel distributed computing using Python}, author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, journal = {Advances in Water Resources}, volume = {34}, number = {9}, pages = {1124 - 1139}, note = {New Computational Methods and Software Tools}, issn = {0309-1708}, doi = {10.1016/j.advwatres.2011.04.013}, year = {2011} } @Article{ behnelbradshawcitrodalcinseljebotnsmith2011, title = {Cython: The Best of Both Worlds}, author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and Seljebotn,Dag Sverre and Smith,Kurt }, journal = {Computing in Science \& Engineering}, volume = {13}, number = {2}, pages = {31-39}, doi = {10.1109/MCSE.2010.118}, year = {2011} } @Article{ dalcinpazstorti2005, title = {MPI for Python}, author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, journal = {Journal of Parallel and Distributed Computing}, volume = {65}, number = {9}, pages = {1108 - 1115}, issn = {0743-7315}, doi = {10.1016/j.jpdc.2005.03.010}, year = {2005} } @Article{ dalcincolliervignalcortescalo2016, title = {PetIGA: A framework for high-performance isogeometric analysis}, author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. Calo}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {308}, pages = {151 - 181}, issn = {0045-7825}, doi = {10.1016/j.cma.2016.05.011}, year = {2016} } @Article{ collierpardodalcinpaszynskicalo2012, title = {The cost of continuity: A study of the performance of isogeometric finite elements using direct solvers}, author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. Calo}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {213-216}, pages = {353 - 361}, issn = {0045-7825}, doi = {10.1016/j.cma.2011.11.002}, year = {2012} } @Article{ collierdalcinpardocalo2013, title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite Elements}, author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, journal = {SIAM Journal on Scientific Computing}, volume = {35}, number = {2}, pages = {A767-A784}, doi = {10.1137/120881038}, year = {2013} } @Article{ dunning2017jump, title = {{JuMP}: a modeling language for mathematical optimization}, author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, journal = {SIAM Review}, volume = {59}, number = {2}, pages = {295--320}, year = {2017}, publisher = {SIAM} } @InProceedings{ prudencioschulz2011, title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for Estimation, Simulation and Optimization}, author = {Ernesto E Prudencio and Karl W Schulz}, booktitle = {European Conference on Parallel Processing}, pages = {398--407}, year = {2011} } @Misc{ rol-website, key = {ROL}, title = {{Rapid Optimization Library} Website}, howpublished = {\url{https://trilinos.org/packages/rol}}, year = {2018} } @Article{ more1994line, title = {Line search algorithms with guaranteed sufficient decrease}, author = {Mor{\'e}, Jorge J and Thuente, David J}, journal = {ACM Transactions on Mathematical Software}, volume = {20}, number = {3}, pages = {286--307}, year = {1994}, publisher = {ACM} } @Article{ griewank2000algorithm, title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or adjoint mode of computational differentiation}, author = {Griewank, Andreas and Walther, Andrea}, journal = {ACM Transactions on Mathematical Software}, volume = {26}, number = {1}, pages = {19--45}, year = {2000}, publisher = {ACM} } @Article{ metcalf2011seven, title = {The seven ages of fortran}, author = {Metcalf, Michael}, journal = {Journal of Computer Science \& Technology}, volume = {11}, year = {2011} } @Article{ giraldo_2013, title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified model of the atmosphere {(NUMA)}}, author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, journal = {SIAM Journal on Scientific Computing}, year = {2013}, number = {5}, pages = {B1162-B1194}, volume = {35}, doi = {10.1137/120876034} } @Article{ constantinescu_tr2016b, author = {Constantinescu, E.M.}, title = {Estimating Global Errors in Time Stepping}, journal = {ArXiv e-prints}, archiveprefix = {arXiv}, eprint = {1503.05166}, primaryclass = {math.NA}, keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, year = {2016}, month = mar, adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, adsnote = {Provided by the SAO/NASA Astrophysics Data System} } @Article{ pareschi_2005, title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems with Relaxation}, author = {L. Pareschi and G. Russo}, journal = {Journal of Scientific Computing}, year = {2005}, number = {1}, pages = {129--155}, volume = {25} } @Article{ kennedy_2003, title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, author = {C.A. Kennedy and M.H. Carpenter}, journal = {Appl. Numer. Math.}, year = {2003}, number = {1-2}, pages = {139--181}, volume = {44}, doi = {10.1016/S0168-9274(02)00138-1}, publisher = {Elsevier Science Publishers B. V.} } @Unpublished{ boscarino_tr2011, title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic equations in the diffusion limit}, author = {Boscarino, S. and Pareschi, L. and Russo, G.}, note = {Arxiv preprint arXiv:1110.4375}, year = {2011} } @Article{ ascher_1997, title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential equations}, author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, journal = {Applied Numerical Mathematics}, year = {1997}, pages = {151--167}, volume = {25} } @Book{ ascherpetzold1998, title = {Computer methods for ordinary differential equations and differential-algebraic equations}, author = {Uri M Ascher and Linda R Petzold}, volume = {61}, publisher = {SIAM}, year = {1998} } @Article{ colomesbadia2016, title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} equations}, author = {Oriol Colom{\'e}s and Santiago Badia}, journal = {International Journal for Numerical Methods in Engineering}, volume = {105}, number = {5}, pages = {372--400}, year = {2016} } @Article{ sandu_1997, title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: {R}osenbrock solvers}, author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. Potra}, journal = {Atmospheric Environment}, year = {1997}, number = {20}, pages = {3459--3472}, volume = {31}, abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major task is the integration of the stiff systems of ordinary differential equations describing the chemical transformations. It is therefore of interest to systematically search for stiff solvers which can be identified as close to optimal for atmospheric applications. In this paper we continue our investigation from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) and compare eight solvers on a set of seven box-models used in present day models. The focus is on Rosenbrock solvers. These turn out to be very well suited for our application when they are provided with highly efficient sparse matrix techniques to economize on the linear algebra. Two of the Rosenbrock solvers tested are from the literature, viz. and 4, and two are new and specially developed for air quality applications, viz. 3 and 3. } } @Article{ rang_2005, title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic equations of index 1}, author = {Rang, J. and Angermann, L.}, journal = {BIT Numerical Mathematics}, year = {2005}, number = {4}, pages = {761--787}, volume = {45}, publisher = {Springer}, doi = {10.1007/s10543-005-0035-y} } @article{rang2015improved, title = {Improved traditional {R}osenbrock--{W}anner methods for stiff {ODE}s and {DAE}s}, author = {Rang, Joachim}, journal = {Journal of Computational and Applied Mathematics}, volume = {286}, pages = {128--144}, year = {2015}, publisher = {Elsevier}, doi = {10.1016/j.cam.2015.03.010} } @Article{ gottliebketchesonshu2009, author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, title = {{High order strong stability preserving time discretizations}}, journal = {Journal of Scientific Computing}, volume = {38}, number = {3}, pages = {251--289}, doi = {10.1007/s10915-008-9239-z}, year = {2009} } @Article{ ZhouGuoShu2001, title = {Numerical study on Landau damping}, author = {Tie Zhou and Yan Guo and Chi Wang Shu}, journal = {Physica D: Nonlinear Phenomena}, volume = {157}, issue = {4}, pages = {322-333}, doi = {10.1016/S0167-2789(01)00289-5}, issn = {01672789}, year = {2001} } @Article{ ketcheson_2008, title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with Low-Storage Implementations}, author = {D.I. Ketcheson}, journal = {SIAM Journal on Scientific Computing}, year = {2008}, number = {4}, pages = {2113--2136}, volume = {30}, doi = {10.1137/07070485X}, keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, RungeKutta methods}, publisher = {SIAM} } @Article{ jansen_2000, title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes equations with a stabilized finite element method}, author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, journal = {Computer Methods in Applied Mechanics and Engineering}, year = {2000}, number = {3}, pages = {305--319}, volume = {190}, publisher = {Elsevier} } @Article{ butcher_2007, title = {Error propagation of general linear methods for ordinary differential equations}, author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, journal = {Journal of Complexity}, year = {2007}, number = {4-6}, pages = {560--580}, volume = {23}, abstract = {We discuss error propagation for general linear methods for ordinary differential equations up to terms of order p+2, where p is the order of the method. These results are then applied to the estimation of local discretization errors for methods of order p and for the adjacent order p+1. The results of numerical experiments confirm the reliability of these estimates. This research has applications in the design of robust stepsize and order changing strategies for algorithms based on general linear methods.}, doi = {10.1016/j.jco.2007.01.009}, issn = {0885-064X} } @Article{ constantinescu_a2010a, title = {Extrapolated implicit-explicit time stepping}, author = {E.M. Constantinescu and A. Sandu}, journal = {SIAM Journal on Scientific Computing}, year = {2010}, number = {6}, pages = {4452-4477}, volume = {31}, comment = {Preprint \# ANL/MCS-P1612-0409}, doi = {10.1137/080732833} } @InProceedings{ devito2011liszt, title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and Aiken, Alex and Duraisamy, Karthik and others}, booktitle = {Proceedings of 2011 International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {9}, year = {2011}, organization = {ACM} } @Article{ devito2011designing, title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, author = {DeVito, Zachary and Hanrahan, Pat}, journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, year = {2011} } @Misc{ pgasintro, author = {Tim Stitt}, title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming Model}, note = {\url{http://cnx.org/content/m20649/latest/}} } @InProceedings{ el2006upc, title = {UPC: unified parallel C}, author = {El-Ghazawi, Tarek and Smith, Lauren}, booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, pages = {27}, year = {2006}, organization = {ACM} } @InProceedings{ numrich1998co, title = {Co-Array Fortran for parallel programming}, author = {Numrich, Robert W and Reid, John}, booktitle = {ACM Sigplan Fortran Forum}, volume = {17}, number = {2}, pages = {1--31}, year = {1998}, organization = {ACM} } @Article{ aiken1997titanium, title = {Titanium: A high-performance Java dialect}, author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, Geoff and Semenzato, Luigi and others}, year = {1997} } @Article{ charles2005x10, title = {X10: an object-oriented approach to non-uniform cluster computing}, author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and Sarkar, Vivek}, journal = {Acm Sigplan Notices}, volume = {40}, number = {10}, pages = {519--538}, year = {2005}, publisher = {ACM} } @Article{ chamberlain2007parallel, title = {Parallel programmability and the chapel language}, author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, journal = {International Journal of High Performance Computing Applications}, volume = {21}, number = {3}, pages = {291--312}, year = {2007}, publisher = {SAGE Publications} } @InProceedings{ charmppoopsla93, author = {{Kal\'{e}}, L.V. and Krishnan, S.}, title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, editor = {Paepcke, A.}, fulleditor = {Paepcke, Andreas}, pages = {91--108}, month = sep, year = {1993}, booktitle = {{Proceedings of OOPSLA'93}}, publisher = {{ACM Press}} } @InProceedings{ hewitt1973universal, title = {A universal modular actor formalism for artificial intelligence}, author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, booktitle = {Proceedings of the 3rd international joint conference on Artificial intelligence}, pages = {235--245}, year = {1973}, organization = {Morgan Kaufmann Publishers Inc.} } @Book{ yonezawa1990abcl, title = {ABCL: an object-oriented concurrent system}, author = {Yonezawa, Akinori}, year = {1990}, publisher = {MIT press} } @InProceedings{ dally1988object, title = {Object-oriented concurrent programming in CST}, author = {Dally, William J and Chien, Andrew A}, booktitle = {Proceedings of the third conference on Hypercube concurrent computers and applications: Architecture, software, computer systems, and general issues-Volume 1}, pages = {434--439}, year = {1988}, organization = {ACM} } @Article{ grimshaw1993easy, title = {Easy-to-use object-oriented parallel processing with Mentat}, author = {Grimshaw, Andrew S.}, journal = {Computer}, volume = {26}, number = {5}, pages = {39--51}, year = {1993}, publisher = {IEEE} } @InProceedings{ gannon1991object, title = {Object oriented parallelism: pC++ ideas and experiments}, author = {Gannon, Dennis and Lee, JK}, booktitle = {Proceedings of}, pages = {13--23}, year = {1991} } @InProceedings{ lau1992object, title = {An object-oriented class library for scalable parallel heuristic search}, author = {Lau, Wing-cheong and Singh, Vineet}, booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, pages = {252--267}, year = {1992}, organization = {Springer} } @Book{ chase1989amber, title = {The Amber system: Parallel programming on a network of multiprocessors}, author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and Littlefield, Richard}, volume = {23}, number = {5}, year = {1989}, publisher = {ACM} } @InProceedings{ kaiser2009parallex, title = {Parallex an advanced parallel execution model for scaling-impaired applications}, author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, pages = {394--401}, year = {2009}, organization = {IEEE} } @TechReport{ ipm, author = {Barry F. Smith}, title = {A New Parallel Programming Model for Computer Simulation}, institution = {Argonne National Laboratory}, year = {2014}, number = {ANL/MCS-P5135-0414} } @Article{ groppsnir, author = {William Gropp and Marc Snir}, title = {Programming for Exascale Computers}, journal = {Computing in Science and Engineering}, volume = {15}, number = {6}, issn = {1521-9615}, year = {2013}, pages = {27-35}, doi = {10.1109/MCSE.2013.96}, publisher = {IEEE Computer Society}, address = {Los Alamitos, CA} } @Book{ mpi3, title = {MPI: A Message-Passing Interface Standard, Version 3.0}, author = {Message Passing Interface Forum}, year = {2012}, publisher = {High Performance Computing Center Stuttgart (HLRS)} } @Book{ openmp4, title = {OpenMP Application Program Interface, Version 4.0}, year = {2013}, publisher = {OpenMP Architecture Review Board} } @InProceedings{ hartono2009annotation, title = {Annotation-based empirical performance tuning using {Orio}}, author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International Symposium on}, pages = {1--11}, year = {2009}, organization = {IEEE} } @Book{ toselli2005domain, title = {Domain Decomposition Methods: Algorithms and Theory}, author = {Toselli, Andrea and Widlund, Olof B}, volume = {34}, year = {2005}, publisher = {Springer} } @InBook{ st2016, author = {Barry F. Smith and Xumin Tu}, chapter = {Domain Decomposition}, title = {Encyclopedia of Applied and Computational Mathematics}, bookeditor = {B. Engquist}, publisher = {Springer}, pages = {375--381}, year = {2016} } @TechReport{ saws, author = {Matt Otten and Jed Brown and Barry F. Smith}, title = {Scientific Application Web Server {(SAWs)} Users Manual}, institution = {Argonne National Laboratory}, year = {2013} } @Article{ smith1997domain, title = {Domain Decomposition Methods for Partial Differential Equations}, author = {Smith, B.F.}, journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, volume = {4}, pages = {225--244}, year = {1997}, publisher = {Citeseer} } @Article{ spillane2011abstract, title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems in the overlaps}, author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and Scheichl, R}, journal = {NuMa-Report}, volume = {7}, pages = {2007}, year = {2011} } @InProceedings{ jolivet2013scalabledd, title = {Scalable domain decomposition preconditioners for heterogeneous elliptic problems}, author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and Prud'homme, Christophe}, booktitle = {Proceedings of SC13: International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {80}, year = {2013}, organization = {ACM} } @Book{ ks2000, author = {D. Kinderlehrer and G. Stampacchia}, publisher = {Society for Industrial Mathematics}, title = {An Introduction to Variational Inequalities and Their Applications}, year = {2000} } @Article{ wan2000energy, title = {An energy-minimizing interpolation for robust multigrid methods}, author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, journal = {SIAM Journal on Scientific Computing}, volume = {21}, number = {4}, pages = {1632--1649}, year = {2000}, publisher = {Philadelphia, PA: SIAM, c1993-} } @Article{ chansmith1994, title = {Domain decomposition and multigrid algorithms for elliptic problems on unstructured meshes}, author = {Chan, T.F. and Smith, B.F.}, journal = {Electronic Transactions on Numerical Analysis}, volume = {2}, pages = {171--182}, year = {1994} } @TechReport{ proto-fsp, author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta and Michael Zarnstorff and Michael Zika}, title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, institution = {Princeton Plasma Physics Laboratory}, year = {2010}, url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} } @Article{ hirvijoki2021, title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for particle-in-cell codes}, journal = {Plasma Phys. Control. Fusion}, author = {Eero Hirvijoki}, note = {in press}, doi = {10.1088/1361-6587/abe884}, year = {2021} } @Article{ ipsen2001, author = {Ilse C. F. Ipsen}, journal = {SIAM J. Sci. Comput.}, pages = {1050--1051}, volume = {23}, publisher = {SIAM}, title = {A Note on Preconditioning Nonsymmetric Matrices}, year = {2001} } % Random papers on solvers for GPUs @InProceedings{ gpus-suck, author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, title = { On the Limits of {GPU} Acceleration}, booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, year = {2010}, publisher = {USENIX} } @InProceedings{ 882364, author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, year = {2003}, isbn = {1-58113-709-5}, pages = {917--924}, location = {San Diego, California}, doi = {10.1145/1201775.882364}, publisher = {ACM}, address = {New York, NY} } @Conference{ feng2008multigrid, author = {Feng, Z. and Li, P.}, booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, date-added = {2010-08-19 15:57:06 -0500}, date-modified = {2010-08-19 15:57:06 -0500}, pages = {647--654}, title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, year = {2008} } @Conference{ goodnight2003multigrid, author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, date-added = {2010-08-19 15:45:20 -0500}, date-modified = {2010-08-19 15:45:20 -0500}, organization = {Eurographics Association}, pages = {102--111}, title = {A multigrid solver for boundary value problems using programmable graphics hardware}, year = {2003} } @Article{ buatois2007concurrent, author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, date-added = {2010-08-19 15:45:02 -0500}, date-modified = {2010-08-19 15:45:02 -0500}, journal = {High Performance Computing and Communications}, pages = {358--371}, publisher = {Citeseer}, title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, year = {2007} } @Article{ joldes2010real, author = {Joldes, G.R. and Wittek, A. and Miller, K.}, date-added = {2010-08-19 15:44:41 -0500}, date-modified = {2010-08-19 15:44:41 -0500}, journal = {Computer Methods in Applied Mechanics and Engineering}, publisher = {Elsevier}, title = {Real-time nonlinear finite element computations on {GPU}-application to neurosurgical simulation}, year = {2010} } @Misc{ aharon2005gpu, author = {Aharon, S.}, date-added = {2010-08-19 15:44:32 -0500}, date-modified = {2010-08-19 15:44:32 -0500}, month = apr, note = {US Patent App. 11/115,642}, publisher = {Google Patents}, title = {{GPU}-based Finite Element}, year = {2005} } @Article{ cevahir2009fast, author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, date-added = {2010-08-19 15:44:01 -0500}, date-modified = {2010-08-19 15:44:01 -0500}, journal = {Computational Science--ICCS 2009}, pages = {893--903}, publisher = {Springer}, title = {Fast conjugate gradients with multiple {GPU}s}, year = {2009} } @Article{ maier1995symmetric, author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, date-added = {2010-08-19 15:43:57 -0500}, date-modified = {2010-08-19 15:43:57 -0500}, journal = {Computational Mechanics}, number = {1}, pages = {115--129}, publisher = {Springer}, title = {Symmetric {G}alerkin boundary element method in plasticity and gradient plasticity}, volume = {17}, year = {1995} } @Article{ corrigan-running, author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, date-added = {2010-08-19 15:43:47 -0500}, date-modified = {2010-08-19 15:43:47 -0500}, journal = {International Journal for Numerical Methods in Fluids}, publisher = {John Wiley \& Sons}, title = {Running unstructured grid based CFD solvers on modern graphics hardware} } @InProceedings{ volkov08, author = {Vasily Volkov and James W. Demmel}, title = {Benchmarking GPUs to tune dense linear algebra}, booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, year = {2008} } @TechReport{ cray-mvmult, author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, institution = {School of Computer Science, Carnegie Mellon University}, number = {CMU-CS-93-173}, month = aug, year = {1993} } @Conference{ bell2009implementing, author = {Bell, N. and Garland, M.}, booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, date-added = {2010-08-19 15:43:42 -0500}, date-modified = {2010-08-19 15:43:42 -0500}, organization = {ACM}, pages = {1--11}, title = {Implementing sparse matrix-vector multiplication on throughput-oriented processors}, year = {2009} } @Article{ bell2008efficient, author = {Bell, N. and Garland, M.}, date-added = {2010-08-19 15:43:36 -0500}, date-modified = {2010-08-19 15:43:36 -0500}, journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, title = {Efficient sparse matrix-vector multiplication on {CUDA}}, year = {2008} } @Article{ cohen-fast, author = {Cohen, J. and Molemaker, M.J.}, date-added = {2010-08-19 15:43:34 -0500}, date-modified = {2010-08-19 15:43:34 -0500}, journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, pages = {414}, publisher = {DEStech Publications}, title = {A fast double precision CFD code using CUDA} } @Article{ kazhdan2008streaming, author = {Kazhdan, M. and Hoppe, H.}, date-added = {2010-08-19 15:43:32 -0500}, date-modified = {2010-08-19 15:43:32 -0500}, journal = {ACM Transactions on Graphics (TOG)}, number = {3}, pages = {21}, publisher = {ACM}, title = {Streaming multigrid for gradient-domain operations on large images}, volume = {27}, year = {2008} } @Article{ bonnet1998symmetric, author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, date-added = {2010-08-19 15:43:18 -0500}, date-modified = {2010-08-19 15:43:18 -0500}, journal = {Appl. Mech. Rev}, pages = {669--704}, title = {Symmetric {G}alerkin boundary element method.}, volume = {51}, year = {1998} } @Conference{ zamith2007gpu, author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and Valente, L.}, booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital Entertainment}, date-added = {2010-08-19 15:43:14 -0500}, date-modified = {2010-08-19 15:43:14 -0500}, pages = {37--43}, title = {The {GPU} used as a math co-processor in real time applications}, year = {2007} } @Article{ baskaran2009optimizing, author = {Baskaran, M.M. and Bordawekar, R.}, date-added = {2010-08-19 15:42:56 -0500}, date-modified = {2010-08-19 15:42:56 -0500}, journal = {IBM Research Report RC24704, IBM}, title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, year = {2009} } @Misc{ szeliski2006locally, author = {Szeliski, R.}, date-added = {2010-08-19 15:42:45 -0500}, date-modified = {2010-08-19 15:42:45 -0500}, month = jul, note = {US Patent App. 11/459,724}, publisher = {Google Patents}, title = {Locally adapted hierarchical basis preconditioning}, year = {2006} } @Article{ jung2006cholesky, author = {Jung, J.H. and O'Leary, D.P.}, date-added = {2010-08-19 15:42:34 -0500}, date-modified = {2010-08-19 15:42:34 -0500}, journal = {Scholarly Paper, University of Maryland}, publisher = {Citeseer}, title = {Cholesky decomposition and linear programming on a {GPU}}, year = {2006} } @Conference{ filipovic2009gpu, author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, date-added = {2010-08-19 15:42:33 -0500}, date-modified = {2010-08-19 15:42:33 -0500}, title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary Results}, year = {2009} } @Article{ taylor2009modelling, author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and Atkinson, D. and Ourselin, S.}, date-added = {2010-08-19 15:42:23 -0500}, date-modified = {2010-08-19 15:42:23 -0500}, journal = {Medical Image Analysis}, number = {2}, pages = {234--244}, publisher = {Elsevier}, title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical solution and {GPU} execution}, volume = {13}, year = {2009} } @Conference{ owens2007survey, author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. and Lefohn, A.E. and Purcell, T.J.}, booktitle = {Computer Graphics Forum}, date-added = {2010-08-19 15:42:21 -0500}, date-modified = {2010-08-19 15:42:21 -0500}, number = {1}, organization = {John Wiley \& Sons}, pages = {80--113}, title = {A survey of general-purpose computation on graphics hardware}, volume = {26}, year = {2007} } @Article{ strzodka2005scientific, author = {Strzodka, R. and Doggett, M. and Kolb, A.}, date-added = {2010-08-19 15:42:18 -0500}, date-modified = {2010-08-19 15:42:18 -0500}, journal = {Simulation Modelling Practice and Theory}, number = {8}, pages = {667--680}, publisher = {Elsevier}, title = {Scientific computation for simulations on programmable graphics hardware}, volume = {13}, year = {2005} } @Conference{ rumpf2001using, author = {Rumpf, M. and Strzodka, R.}, booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference (VIIP-01)}, date-added = {2010-08-19 15:42:15 -0500}, date-modified = {2010-08-19 15:42:15 -0500}, organization = {Citeseer}, pages = {193--202}, title = {Using graphics cards for quantized FEM computations}, year = {2001} } @Article{ sirtori1992galerkin, author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, date-added = {2010-08-19 15:42:14 -0500}, date-modified = {2010-08-19 15:42:14 -0500}, journal = {International Journal for Numerical Methods in Engineering}, number = {2}, pages = {255--282}, publisher = {John Wiley \& Sons}, title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and implementation}, volume = {35}, year = {1992} } @Article{ tejada2005large, author = {Tejada, E. and Ertl, T.}, date-added = {2010-08-19 15:42:09 -0500}, date-modified = {2010-08-19 15:42:09 -0500}, journal = {Simulation Modelling Practice and Theory}, number = {8}, pages = {703--715}, publisher = {Elsevier}, title = {Large steps in {GPU}-based deformable bodies simulation}, volume = {13}, year = {2005} } @Article{ goddeke2008using, author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. and Becker, C. and Turek, S.}, date-added = {2010-08-19 15:42:06 -0500}, date-modified = {2010-08-19 15:42:06 -0500}, journal = {International Journal of Computational Science and Engineering}, number = {1}, pages = {36--55}, publisher = {Inderscience}, title = {Using {GPU}s to improve multigrid solver performance on a cluster}, volume = {4}, year = {2008} } @Article{ garland2008parallel, author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, date-added = {2010-08-19 15:41:51 -0500}, date-modified = {2010-08-19 15:41:51 -0500}, journal = {IEEE Micro}, number = {4}, pages = {13--27}, title = {Parallel computing experiences with CUDA}, volume = {28}, year = {2008} } @Article{ wong1985method, author = {Wong, SH and Ciric, IR}, date-added = {2010-08-19 15:41:48 -0500}, date-modified = {2010-08-19 15:41:48 -0500}, journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical and Electronic Engineering}, publisher = {MCB UP Ltd}, title = {Method of conformal transformation for the finite-element solution of axisymmetric exterior-field problems}, volume = {4}, year = {1985} } @Article{ turek-feast, author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, H.}, date-added = {2010-08-19 15:41:47 -0500}, date-modified = {2010-08-19 15:41:47 -0500}, journal = {Concurrency and Computation: Practice and Experience}, publisher = {John Wiley \& Sons}, title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite elements} } @Article{ abedi2006space, author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, date-added = {2010-08-19 15:41:46 -0500}, date-modified = {2010-08-19 15:41:46 -0500}, journal = {Computer Methods in Applied Mechanics and Engineering}, number = {25-28}, pages = {3247--3273}, publisher = {Elsevier}, title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with element-wise momentum balance}, volume = {195}, year = {2006} } @Conference{ georgii2005interactiveb, author = {Georgii, J. and Westermann, R.}, booktitle = {Proceedings of VMV}, date-added = {2010-08-19 15:41:36 -0500}, date-modified = {2010-08-19 15:41:36 -0500}, title = {Interactive simulation and rendering of heterogeneous deformable bodies}, year = {2005} } @Article{ mosegaard2005gpu, author = {Mosegaard, J. and others}, date-added = {2010-08-19 15:41:35 -0500}, date-modified = {2010-08-19 15:41:35 -0500}, publisher = {IEEE Computer Society}, title = {{GPU} accelerated surgical simulators for complex morphology}, year = {2005} } @Article{ meyer2007particle, author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, date-added = {2010-08-19 15:41:33 -0500}, date-modified = {2010-08-19 15:41:33 -0500}, journal = {IEEE Transactions on Visualization and Computer Graphics}, pages = {1015--1026}, publisher = {Published by the IEEE Computer Society}, title = {Particle systems for efficient and accurate high-order finite element visualization}, year = {2007} } @Conference{ rumpf2001nonlinear, author = {Rumpf, M. and Strzodka, R.}, booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, date-added = {2010-08-19 15:41:29 -0500}, date-modified = {2010-08-19 15:41:29 -0500}, organization = {Springer Verlag Wien}, pages = {75}, title = {Nonlinear diffusion in graphics hardware}, year = {2001} } @Article{ georgii2005interactive, author = {Georgii, J. and Echtler, F. and Westermann, R.}, date-added = {2010-08-19 15:41:28 -0500}, date-modified = {2010-08-19 15:41:28 -0500}, journal = {Simulation and Visualisation}, pages = {247--258}, publisher = {Citeseer}, title = {Interactive simulation of deformable bodies on {GPU}s}, volume = {2005}, year = {2005} } @Article{ harish2007accelerating, author = {Harish, P. and Narayanan, P.}, date-added = {2010-08-19 15:41:27 -0500}, date-modified = {2010-08-19 15:41:27 -0500}, journal = {High Performance Computing--HiPC 2007}, pages = {197--208}, publisher = {Springer}, title = {Accelerating large graph algorithms on the {GPU} using CUDA}, year = {2007} } @Article{ keunings1995parallel, author = {Keunings, R.}, date-added = {2010-08-19 15:41:19 -0500}, date-modified = {2010-08-19 15:41:19 -0500}, journal = {Computers and Chemical Engineering}, number = {6}, pages = {647--670}, publisher = {Oxford; New York: Pergamon Press, 1977-}, title = {Parallel finite element algorithms applied to computational rheology}, volume = {19}, year = {1995} } @Conference{ taylor2007real, author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, booktitle = {Proceedings of the 10th international conference on Medical image computing and computer-assisted intervention-Volume Part I}, date-added = {2010-08-19 15:41:17 -0500}, date-modified = {2010-08-19 15:41:17 -0500}, organization = {Springer-Verlag}, pages = {701--708}, title = {Real-time nonlinear finite element analysis for surgical simulation using graphics processing units}, year = {2007} } @Article{ liu2000finite, author = {Liu, R. and Li, DY}, date-added = {2010-08-19 15:41:16 -0500}, date-modified = {2010-08-19 15:41:16 -0500}, journal = {Materials Science and Engineering A}, number = {1-2}, pages = {169--175}, publisher = {Elsevier}, title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, volume = {277}, year = {2000} } @Conference{ kakadiaris1994active, author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, date-added = {2010-08-19 15:41:15 -0500}, date-modified = {2010-08-19 15:41:15 -0500}, organization = {Citeseer}, pages = {980--980}, title = {Active part-decomposition, shape, and motion estimation of articulated objects: A physics-based approach}, year = {1994} } @Conference{ de2004gpu, author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, booktitle = {Proceedings of Eurohaptics}, date-added = {2010-08-19 15:41:14 -0500}, date-modified = {2010-08-19 15:41:14 -0500}, organization = {Citeseer}, pages = {44--51}, title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, volume = {2004}, year = {2004} } @Book{ taflove1995computational, author = {Taflove, A. and Hagness, S.C.}, date-added = {2010-08-19 15:41:14 -0500}, date-modified = {2010-08-19 15:41:14 -0500}, publisher = {Artech House Norwood, MA}, title = {Computational electrodynamics}, year = {1995} } @Conference{ galoppo2005lu, author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, date-added = {2010-08-19 15:41:13 -0500}, date-modified = {2010-08-19 15:41:13 -0500}, organization = {IEEE Computer Society}, pages = {3}, title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics hardware}, year = {2005} } @Conference{ ryoo2008optimization, author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. and Hwu, W.W.}, booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of parallel programming}, date-added = {2010-08-19 15:41:12 -0500}, date-modified = {2010-08-19 15:41:12 -0500}, organization = {ACM}, pages = {73--82}, title = {Optimization principles and application performance evaluation of a multithreaded {GPU} using CUDA}, year = {2008} } @Conference{ micikevicius20093d, author = {Micikevicius, P.}, booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing Units}, date-added = {2010-08-19 15:41:11 -0500}, date-modified = {2010-08-19 15:41:11 -0500}, organization = {ACM}, pages = {79--84}, title = {3D finite difference computation on {GPU}s using {CUDA}}, year = {2009} } @Conference{ zhou2004pixel, author = {Zhou, Y. and Garland, M. and Haber, R.}, booktitle = {IEEE Visualization, 2004}, date-added = {2010-08-19 15:41:03 -0500}, date-modified = {2010-08-19 15:41:03 -0500}, pages = {425--432}, title = {Pixel-exact rendering of spacetime finite element solutions}, year = {2004} } @Article{ komatitsch2009porting, author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, date-added = {2010-08-19 15:41:01 -0500}, date-modified = {2010-08-19 15:41:01 -0500}, journal = {Journal of Parallel and Distributed Computing}, number = {5}, pages = {451--460}, publisher = {Elsevier}, title = {Porting a high-order finite-element earthquake modeling application to NVIDIA graphics cards using CUDA}, volume = {69}, year = {2009} } @Article{ komatitsch1998spectral, author = {Komatitsch, D. and Vilotte, J.P.}, date-added = {2010-08-19 15:40:59 -0500}, date-modified = {2010-08-19 15:40:59 -0500}, journal = {Bulletin of the Seismological Society of America}, number = {2}, pages = {368--392}, publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, title = {The spectral element method: {A}n efficient tool to simulate the seismic response of 2D and 3D geological structures}, volume = {88}, year = {1998} } @Article{ wu2005improved, author = {Wu, W. and Heng, P.A.}, date-added = {2010-08-19 15:40:59 -0500}, date-modified = {2010-08-19 15:40:59 -0500}, journal = {The Visual Computer}, number = {8}, pages = {707--716}, publisher = {Springer}, title = {An improved scheme of an interactive finite element model for 3D soft-tissue cutting and deformation}, volume = {21}, year = {2005} } @Article{ taylor2008high, author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, date-added = {2010-08-19 15:40:57 -0500}, date-modified = {2010-08-19 15:40:57 -0500}, journal = {IEEE transactions on medical imaging}, number = {5}, pages = {650}, title = {High-speed nonlinear finite element analysis for surgical simulation using graphics processing units.}, volume = {27}, year = {2008} } @Conference{ bolz2003sparse, author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, booktitle = {ACM SIGGRAPH 2003 Papers}, date-added = {2010-08-19 15:40:55 -0500}, date-modified = {2010-08-19 15:40:55 -0500}, organization = {ACM}, pages = {924}, title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, year = {2003} } @Article{ wu2004hybrid, author = {Wu, W. and Heng, P.A.}, date-added = {2010-08-19 15:40:54 -0500}, date-modified = {2010-08-19 15:40:54 -0500}, journal = {Computer Animation and Virtual Worlds}, number = {3-4}, pages = {219--227}, publisher = {John Wiley \& Sons}, title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 3D soft tissue cutting}, volume = {15}, year = {2004} } % ---------------------------------------------------------------------------------------------------------------- @TechReport{ davis97, author = {T. Davis}, title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, institution = {University of Florida}, year = {1997} } @Article{ davis2011, author = {Davis, T. A. and Hu, Y.}, title = {The {U}niversity of {F}lorida sparse matrix collection}, journal = {ACM Transactions on Mathematical Software}, volume = {38}, issue = {1}, year = {2011}, pages = {1--25} } @Article{ davis2004algorithm, title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, author = {Davis, Timothy A}, journal = {ACM Transactions on Mathematical Software}, volume = {30}, number = {2}, pages = {196--199}, year = {2004}, publisher = {ACM} } @TechReport{ streams, author = {J. D. McCalpin}, title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, institution = {University of Virginia}, url = {http://www.cs.virginia.edu/stream}, year = {1995} } @Article{ areusken_1988b, author = {A. Reusken}, title = {Convergence of the multigrid full approximation scheme for a class of elliptic mildly nonlinear boundary value problems}, journal = {Numer. Math.}, volume = {52}, year = {1988}, pages = {251--277} } @Article{ areusken_1988c, author = {A. Reusken}, title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, journal = {Numer. Math.}, volume = {53}, year = {1988}, pages = {663--686} } @Unpublished{ mgnet, title = {Multigrid Net; http://www.mgnet.org/}, author = {Craig Douglas}, note = {Contains enormous bibliography on multigrid publications}, year = {2009} } @Unpublished{ copper, title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, author = {}, note = {Held bi-annually}, year = {2009} } @Book{ wessling1992, author = {Pieter Wesseling}, title = {An Introduction to Multigrid Methods}, year = {2004}, publisher = {R. T. Edwards} } @Book{ bhm2000, author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, title = {A Multigrid Tutorial}, year = {2000}, publisher = {SIAM} } @Book{ trottenberg2001multigrid, title = {{Multigrid}}, author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, isbn = {012701070X}, year = {2001}, publisher = {Academic Press} } @TechReport{ brandt1984, author = {Achi Brandt}, title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, number = {GMD-Studien Nr. 85}, year = {1984} } @Article{ yavneh1998coarse, title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, author = {Yavneh, I.}, journal = {SIAM Journal on Scientific Computing}, volume = {19}, number = {5}, pages = {1682--1699}, year = {1998}, publisher = {Society for Industrial and Applied Mathematics} } @Article{ wan2003phase, title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, author = {Wan, WL and Chan, T.F.}, journal = {SIAM Journal on Scientific Computing}, volume = {25}, pages = {857}, year = {2003} } @Article{ imex, author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, journal = {SIAM Journel on Numerical Analysis}, volume = {32}, number = {3}, pages = {797--823}, year = {1995} } @Article{ ow1, author = {T. Washio and C. W. Oosterlee}, title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to Recirculating Flow}, journal = {SIAM Journal on Scientific Computing}, volume = {21}, number = {5}, pages = {1670--1690}, year = {2000} } @Article{ vm1, author = {V. A. Mousseau}, title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear Heat Conduction}, journal = {Journal Of Computational Physics}, volume = {200}, pages = {104--132}, year = {2004} } @Article{ vm2, author = {V. A. Mousseau}, title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, journal = {Journal Of Heat Transfer}, volume = {127}, pages = {531--539}, year = {2005} } @Misc{ salome1, author = {Laurent Dada and Daniel Caruge}, title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics Simulation}, year = {2005}, url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, note = {Presentation at an ESA/ESTEC conference} } @InProceedings{ downar1, author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. A. Mousseau and D. E. Ebert}, title = {Application of a generalized interface module to the coupling of {PARCS} with both {RELAP5} and {TRAC-M}}, booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, year = {1999} } @Article{ lopez1, author = {A. P. Lopez and J. B. Sandova}, title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} thermal-hydraulics}, journal = {Annals of Nuclear Energy}, volume = {32(6)}, pages = {621--634}, year = {2005} } @InProceedings{ og-1996, author = {C. R. E. de Oliveira and A. J. H. Goddard}, title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation Transport Code}, booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation Transport Codes}, editor = {}, publisher = {}, pages = {}, note = {Paris, France}, month = dec, year = {1996} } @Article{ wo-2000, author = {P. Warner and C. R. E. de Oliveira}, title = {Verification and Validation of the 3D Finite Element Transport Theory Code {EVENT} for Shielding Applications}, journal = {J. Nucl. Sci. and Tech.}, volume = {Supplement 1}, pages = {466--470}, year = {2000} } @Unpublished{ gnep-web, author = {{U.S. Department of Energy}}, title = {Global Nuclear Energy Partnership ({GNEP})}, note = {\url{ http://www.gnep.energy.gov}}, year = {2007} } @Book{ lewis-miller-1984, author = {E. E. Lewis and W. F. Miller, Jr.}, title = {Computational Methods of Neutron Transport}, address = {}, publisher = {Wiley}, year = {1984} } @Article{ couple1, author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON THE {IBM-704}}, journal = {Nuclear Sci. and Eng.}, year = {1959}, pages = {113--115}, volume = {2(1)} } @InProceedings{ weber1, author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel and component design}, booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, year = {2000} } @Misc{ gnep:report, author = {Phillip Finck and David Keyes and Rick Stevens}, title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced Nuclear Energy Systems}}, year = {2006} } @Misc{ subsurface-workshop-ref, author = {D. {Zachman (Chair)}}, title = {{Computational Subsurface Sciences Workshop}}, note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} } @Misc{ fusion:report, title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy Panel}}, author = {{Fusion Energy Sciences Advisory Committee}}, year = {2002}, note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} } @Misc{ hecrtf:report, title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, key = {HECRTF}, year = {2004}, howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} } @Misc{ doesc20years, title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, key = {Office of Science, U.S. Department of Energy}, year = {2003}, howpublished = {Office of Science, U.S. Department of Energy, see \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} } @PhDThesis{ karpeev-thesis, author = {D. A. Karpeyev}, title = {Geometric Integrators for Hamiltonian PDEs}, school = {Old Dominion University}, year = {2002} } @InCollection{ fjp:ima, author = {Lori Freitag and Mark Jones and Paul Plassmann}, title = {The Scalability of Mesh Improvement Algorithms}, booktitle = {Algorithms for Parallel Processing}, publisher = {Springer-Verlag}, volume = {105}, series = {The IMA Volumes in Mathematics and Its Applications}, editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, year = {1998}, pages = {185--212} } @InProceedings{ poet, author = {Rob Armstrong and Alex Cheung}, title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks for Scientific Distributed Computing}, booktitle = {Proceedings of {HICSS97}}, year = {1997} } @Misc{ pseware-web-page, author = {}, title = {{PSEware} {Web} page}, note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, key = {{PSEware} {Web} page} } @Article{ epperly2011high, title = {High-performance language interoperability for scientific computing through {B}abel}, author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and Leek, Jim and Prantl, Adrian and Kohn, Scott}, journal = {International Journal of High Performance Computing Applications}, pages = {1094342011414036}, year = {2011}, publisher = {SAGE Publications} } @Misc{ babel-web-page, author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, title = {{Babel} {Web} page}, note = {\url{http://www.llnl.gov/CASC/components/babel.html}} } @Misc{ infospheres-web-page, author = {K.~M. {Chandy et al.}}, title = {{Infospheres} {W}eb page}, note = {\url{http://www.infospheres.caltech.edu}}, key = {{Infospheres} {Web} page} } @Misc{ hammond, author = {Glenn Hammond}, title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private communication} } @Misc{ ornl, author = {Oak Ridge National Laboratory}, title = {Private communication via petsc-maint email support} } @Unpublished{ cumulvs-web-page, author = {}, title = {{Cumulvs} {W}eb page}, note = {http://www.epm.ornl.gov/cs/cumulvs.html}, key = {{Cumulvs} {W}eb page} } @Article{ nonlineargmres, author = {T. Washio and C. W. Oosterlee}, title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, journal = {ETNA}, year = {1997}, pages = {271--290}, volume = {6} } @Article{ pcice, author = {Richard C. Martineau and Ray A. Berry}, title = {The pressure-corrected ICE finite element method for compressible flows on unstructured meshes}, journal = {Journal of Computational Physics}, year = {2004}, pages = {659--685}, volume = {198(2)} } @Article{ cumulvs97, author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel Applications}, journal = {International Journal of Supercomputing Applications}, year = {1997} } @TechReport{ daly2012interagency, author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and Paul Woodward}, title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, year = {2012}, publisher = {US Department of Defense} } @Article{ karpeev1, author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, journal = {J. Comp. Phys.}, year = {2001}, pages = {116--148}, volume = {173} } @InProceedings{ scirun97, author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, title = {The {SCIRun} Computational Steering System}, booktitle = {Modern Software Tools in Scientific Computing}, editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, publisher = {Birkhauser Press}, year = {1997} } @TechReport{ szyld, author = {Valeria Simoncini and Daniel B. Szyld}, title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific Computing}, year = {2002}, institution = {Department of Mathematics, Temple University}, number = {02-4-12} } @TechReport{ pdelab, author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill and C. C. Chui and S. Markus}, title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments for {PDE} Based Applications}, year = {1994}, institution = {Department of Computer Sciences, Purdue University}, number = {CSD-TR-94-021} } @Unpublished{ ilu-web-page, author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, title = {{I}nter-{L}anguage {U}nification Reference Manual}, note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} } @Unpublished{ doe2k-web-page, title = {{DOE2000 Initiative} {W}eb page}, note = {http://www.mcs.anl.gov/DOE2000}, key = {DOE2000 Initiative} } @Misc{ pvode-web-page, title = {{PVODE} {W}eb Page}, note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, author = {A. {Hindmarsh et al.}} } @Book{ szyperski97, author = {Clemens Szyperski}, title = {Component Software: Beyond Object-Oriented Programming}, publisher = {ACM Press}, address = {New York}, year = {1997} } @Unpublished{ petsc:coloringuse, title = {Code for computing sparse {J}acobians}, note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, institution = {Argonne National Laboratory} } @Unpublished{ petsc:external, author = {B. F. {Smith et al.}}, title = {{External Software Used by PETSc}}, note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, institution = {Argonne National Laboratory} } @Unpublished{ petsc:use-by-external-packages, author = {B. F. {Smith et al.}}, title = {{Software Packages that Use or Interface to PETSc}}, note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, institution = {Argonne National Laboratory} } @Unpublished{ petsc:prizes, author = {B. F. {Smith et al.}}, title = {{Prizes Won Using PETSc}}, note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, institution = {Argonne National Laboratory} } @Unpublished{ petsc:csgf, author = {B. F. {Smith et al.}}, title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, institution = {Argonne National Laboratory} } @Unpublished{ flash-web-page, title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes {W}eb Page}, note = {http://www.asci.uchicago.edu}, author = {R. {Rosner et al.}}, institution = {University of Chicago} } @Unpublished{ esi-web-page, title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, note = {http://z.ca.sandia.gov/esi}, author = {R. {Clay et al.}} } @Unpublished{ infobus-web-page, title = {{I}nfo{B}us {W}eb Page}, note = {http://www.java.sun.com/beans/infobus}, key = {infobus} } @Unpublished{ xray-web-page, title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, note = {http://www.mcs.anl.gov/xray/}, institution = {Argonne National Laboratory} } @InProceedings{ kohn98, author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, title = {Language Interoperability Mechanisms for High-Performance Scientific Applications}, publisher = {SIAM}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, year = {1999}, pages = {30-39} } @InProceedings{ kohn01, author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, title = {Divorcing Language Dependencies from a Scientific Software Library}, publisher = {SIAM}, booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, year = {2001} } @InProceedings{ freitag_jones_plassmann98, author = {Lori Freitag and Mark Jones and Paul Plassmann}, title = {Component Integration for Unstructured Mesh Algorithms and Software}, publisher = {SIAM}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, year = {1999}, pages = {215-224} } @Book{ templates, author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative Methods}, publisher = {SIAM}, year = {1994}, address = {Philadelphia, PA} } @InProceedings{ parasha2, author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for {PDE} Solutions}, booktitle = {SC97 Proceedings}, publisher = {IEEE Computer Society Press}, year = {1997} } @TechReport{ parasha, author = {M. Parashar and J. C. Browne}, title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement Techniques}, institution = {Department of Computer Science, University of Texas at Austin}, year = {1995} } @Article{ parti, author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, title = {Communication Optimizations for Irregular Scientific Computations on Distributed Memory Architectures}, journal = {Journal of Parallel and Distributed Computing}, year = {1994}, volume = {22}, pages = {462--478} } @Article{ mparti, author = {G. Agrawal and A. Sussman and J. Saltz}, title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and Block Structured Applications}, journal = {IEEE Trans. on Parallel and Distributed Systems}, volume = {6}, number = {7}, year = {1995} } @Article{ gropp-lusk-doss-skjellum, author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, title = {A high-performance, portable implementation of the {MPI} Message Passing Interface standard}, journal = {Parallel Computing}, year = {1996}, volume = {22}, pages = {789--828} } @InProceedings{ lam, author = {Greg Burns and Raja Daoud and James Vaigl}, title = {{LAM}: An Open Cluster Environment for {MPI}}, booktitle = {Proceedings of Supercomputing Symposium '94}, editor = {John W. Ross}, publisher = {University of Toronto}, pages = {379--386}, year = {1994} } @Article{ cs99, author = {X.-C. Cai and M. Sarkis}, title = {A restricted additive {S}chwarz preconditioner for general sparse linear systems}, journal = {SIAM J. Scientific Computing}, year = {1999}, volume = {21}, pages = {792-797} } @Article{ cai2003restricted, title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric positive definite linear systems}, author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, journal = {SIAM Journal on Numerical Analysis}, volume = {41}, issue = {1}, pages = {1209--1231}, year = {2003}, doi = {10.1137/S0036142901389621} } @TechReport{ caisaad, author = {Xiao-Chuan Cai and Youcef Saad}, title = {Overlapping domain decomposition algorithms for general sparse matrices}, institution = {Army High Performance Computing Research Center, University of Minnesota }, year = {1993}, number = {Preprint 93-027 }, note = {SIAM J. Sci. Comp. (submitted)} } @Book{ ruminations, author = {Andrew Koenig and Barbara Moo}, title = {Ruminations on C++}, year = {1996}, publisher = {Addison-Wesley} } @Book{ mpi-complete, author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack Dongarra}, title = {{MPI}: The Complete Reference}, year = {1995}, publisher = {MIT Press} } @Unpublished{ tcl-tk-web-page, title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, note = {http://www.sunlabs.com/research/tcl/}, year = {1996}, month = aug } @Misc{ mpich-web-page, author = {William Gropp and {et. al.}}, title = {{MPICH} {W}eb page}, key = {MPICH}, url = {http://www.mpich.org}, howpublished = {\url{http://www.mpich.org}} } @Article{ mpi-final, author = {MPI Forum}, title = {{MPI}: A Message-Passing Interface Standard}, journal = {International J. Supercomputing Applications}, volume = {8}, number = {3/4}, year = {1994}, key = {MPI Standard - final} } @Unpublished{ npb-web-page, key = {NAS Parallel Benchmarks}, title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, year = {1996}, month = dec } @Book{ george81, title = {Computer Solution of Large Sparse Positive Definite Systems}, author = {Alan George and Joseph W. Liu}, publisher = {Prentice-Hall}, year = {1981}, key = {SparseDirect} } @Book{ p4-book, title = {Portable Programs for Parallel Processors}, publisher = {Holt, Rinehart, {and} Winston}, year = {1987}, author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing Lusk and Ross Overbeek and James Patterson and Rick Stevens}, key = {P4Book} } @Article{ stones, author = {H. L. Stone}, title = {Iterative solution of implicit approximations of multidimensional partial differential equations}, journal = {SIAM J. Numerical Analysis}, pages = {87--113}, volumne = {5}, year = {1968} } @Article{ parallelstones, author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, title = {Parallel versions of {S}tones strongly implicit algorithm}, journal = {Concurrency and Computation: Practice and Experience}, pages = {1049--1062}, volumne = {13}, year = {2001} } @Article{ p4-paper, author = {Ralph Butler and Ewing Lusk}, title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, journal = {Journal of Parallel Computing}, note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science Division preprint P362-0493)}, year = {1993} } @TechReport{ picl, author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, title = {{PICL}: A portable instrumented communications library}, institution = {Oak Ridge National Laboratory}, number = {TM-11130}, year = {1990}, key = {PICL} } @TechReport{ upshot, author = {Virginia Herrarte and Ewing Lusk}, title = {Studying Parallel Program Behavior with {U}pshot}, institution = {Argonne National Laboratory}, number = {ANL-91/15}, month = aug, year = {1991}, key = {Upshot} } @TechReport{ p4-manual, author = {Ralph Butler and Ewing Lusk}, title = {User's Guide to the p4 Parallel Programming System}, institution = {Argonne National Laboratory}, number = {ANL-92/17}, month = oct, year = {1992}, key = {p4-Manual} } @InProceedings{ oldparti, author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, booktitle = {Proceedings of Supercomputing '93}, pages = {578--587}, year = {1993} } @Article{ parti2, author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers and J. Saltz}, title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, journal = {ACM SIGPLAN Notices}, year = {1995}, pages = {68-79}, volume = {30}, number = {8} } @Article{ parti3, author = {J. Saltz and R. Mirchandaney and K. Crowley}, title = {Run-Time Parallelization and Scheduling of Loops}, journal = {IEEE Trans. Computers}, year = {1991}, pages = {604-612}, volume = {40}, number = {5} } @InProceedings{ disz-lusk:wamtrace, author = {Terrence Disz and Ewing Lusk}, title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, year = {1987}, pages = {46--53} } @InProceedings{ gorlick-kesselman:gauge, author = {Michael Gorlick and Carl Kesselman}, title = {Timing {Prolog} programs without Clocks}, booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, year = {1996}, publisher = {Birkhauser} } @TechReport{ aztec, author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, title = {Aztec User's Guide Version 1.1}, institution = {Sandia National Laboratories}, month = oct, year = {1995}, number = {SAND95/1559} } @TechReport{ aztec2, author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, title = {Official {Aztec} User's Guide Version 2.1}, institution = {Sandia National Laboratories}, year = {1999} } @Book{ taylor-chandy:pcn, author = {Chandy, M. and Taylor, S.}, title = {An Introduction to Parallel Programming}, year = {1991}, publisher = {Jones and Bartlett} } @Book{ foster-taylor:strand, title = {Strand: New Concepts in Parallel Programming}, author = {Ian Foster and Stephen Taylor}, publisher = {Prentice-Hall}, adress = { Englewood Cliffs, New Jersey}, year = {1990} } @Article{ aurora, author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. Carlsson and A. Ciepielewski and B. Hausman}, title = {The Aurora OR-Parallel Prolog System}, journal = {New Generation Computing}, volume = {7}, number = {3}, year = {1990}, pages = {243--271} } @TechReport{ roo, author = {E. Lusk and W. McCune and J. Slaney}, title = {Roo---a Parallel Theorem Prover}, institution = {Argonne National Laboratory}, number = {MCS--TM--149}, year = {1991} } @TechReport{ heath-etheridge:vppp, author = {M. T. Heath and J. A. Etheridge}, title = {Visualizing the Performance of Parallel Programs}, institution = {Oak Ridge National Laboratory}, number = {ORNL TM-11813}, year = {1991} } @TechReport{ chem:vis, author = {Ewing L. Lusk}, title = {Performance Visualization for Parallel Programs}, institution = {Argonne National Laboratory}, number = {ANL/MCS--P287--0192}, year = {1991}, note = {(to appear in {\em Theoretica Chimica Acta})} } @TechReport{ picltrace, author = {P.~H.~Worley}, title = {A new {PICL} trace file format}, institution = {Oak Ridge National Laboratory}, number = {ORNL TM-12125}, month = jun, year = {1992} } @InProceedings{ hideo, author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, title = {Inference of Phylogenetic trees using maximum likelihood}, booktitle = {Proceedings of the First Intel Delta Applications Workshop}, year = {1992}, pages = {247--262} } @InProceedings{ dw90, author = {M. Dryja and O. Widlund}, title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic Problems}, booktitle = {Third International Symposium on Domain Decomposition Methods}, editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, year = {1990}, pages = {3-21}, publisher = {SIAM}, address = {Philadelphia}, annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 references, good introduction to the theory. No computations}, key = {DryjaWidlund90 !AS} } @Unpublished{ rosing, author = {Matt Rosing and Joel Saltz}, title = {Low Latency Messages on Distributed Memory Multiprocessors}, key = {LowLatency}, note = {manuscript, 1992} } @TechReport{ jp:incomplete, author = {Mark T. Jones and Paul E. Plassmann}, title = {An Improved Incomplete {C}holesky Factorization}, institution = {Argonne National Laboratory}, address = {Argonne, IL}, type = {Preprint}, note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, number = {MCS-P206-0191}, year = {1991}, key = {jones} } @InCollection{ jp:ima, author = {Mark Jones and Paul Plassmann}, title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, booktitle = {Graph Theory and Sparse Matrix Computation}, publisher = {Springer-Verlag}, series = {The IMA Volumes in Mathematics and Its Applications}, editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, volume = {56}, year = {1993}, pages = {229--245} } @Article{ pw98, author = {M. Pernice and H. F. Walker}, title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, journal = {SIAM J. Sci. Stat. Comput.}, year = {1998}, volume = {19}, pages = {302--318} } @TechReport{ ysmp83, key = {Eisenstat}, author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, institution = {Department of Computer Science, Yale University}, number = {YALE/DCS/RR-265}, month = apr, year = {1983} } @InBook{ ysmp84, author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, title = {Elliptic Problem Solvers II}, publisher = {Academic Press}, pages = {45--52}, editors = {G. Birkhoff and A. Schoenstadt}, year = {1984} } @TechReport{ sparsekit, key = {Saad}, author = {Youcef Saad}, title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, institution = {Center for Supercomputing Research and Development, University of Illinois at Urbana-Champaign}, number = {1029}, year = {1990} } @TechReport{ pde-user-ref, author = {Barry F. Smith}, title = {Extensible {PDE} Solvers Package Users Manual}, institution = {Argonne National Laboratory}, month = sep, year = {1994}, number = {ANL-93/40}, key = {Smith94 ! PDE} } @TechReport{ bs-user-ref, author = {Mark T. Jones and Paul E. Plassmann}, title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution of Sparse Linear Systems}, institution = {Argonne National Laboratory}, month = dec, year = {1995}, number = {ANL-95/48} } @TechReport{ snes-user-ref, author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, institution = {Argonne National Laboratory}, month = feb, year = {1995}, number = {ANL/MCS-TM-193}, key = {GroppMcInnesSmith95 ! SNES} } @TechReport{ sles-user-ref, author = {William D. Gropp and Barry F. Smith}, title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, institution = {Argonne National Laboratory}, month = mar, year = {1993}, number = {ANL-93/8}, key = {GroppSmith93 ! SLES} } @TechReport{ chameleon-user-ref, author = {William D. Gropp and Barry F. Smith}, title = {Chameleon Parallel programming tools Users Manual}, institution = {Argonne National Laboratory}, month = mar, year = {1993}, number = {ANL-93/23}, key = {GroppSmith93 ! Chameleon} } @Article{ euclid2, author = {D. Hysom and A. Pothen}, title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, journal = {SIAM J. Sci. Comput.}, volume = {22}, number = {6}, pages = {2194--2215} } @TechReport{ euclid1, author = {D. Hysom and A. Pothen}, title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel Solution of Sparse Linear Systems)}, institution = {Old Dominion University}, year = {2001} } @TechReport{ ksp-user-ref, author = {William D. Gropp and Barry F. Smith}, title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space Methods}, institution = {Argonne National Laboratory}, month = aug, year = {1993}, number = {ANL-93/30}, key = {GroppSmith93 ! KSP} } @TechReport{ mpi-chameleon, author = {William D. Gropp and Ewing Lusk}, title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, institution = {Argonne National Laboratory}, month = dec, year = {1992}, number = {ANL-92/47}, key = {GroppLusk92 ! MPI} } @TechReport{ blockcomm-fortran, author = {William D. Gropp}, title = {Block{C}omm for {F}ortran}, institution = {Argonne National Laboratory}, month = may, year = {1993}, number = {ANL-93/00 (to appear)}, key = {Gropp93 ! BlockComm} } @TechReport{ autodocument, author = {William D. Gropp}, title = {Automatic documentation of {C} programs}, institution = {Argonne National Laboratory}, month = may, year = {1993}, number = {ANL-93/00}, key = {Gropp93 ! Autodoc} } @TechReport{ zipcode, author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and Manfred Morari}, title = {The {Z}ipcode message-passing system}, institution = {Lawrence Livermore National Laboratory}, month = sep, year = {1992}, number = {Unpublished}, key = {Skjellum92 ! Zipcode} } @Article{ paragraph, author = {Michael T. Heath and Jennifer Etheridge Finger}, title = {Visualizing performance of parallel programs}, journal = {IEEE Software}, volume = {8}, number = {5}, month = sep, year = {1991}, pages = {29--39}, key = {Heath91 ! Paragraph} } @Article{ gropp90, author = {William Gropp and Edward Smith}, title = {Computational Fluid Dynamics on Parallel Processors}, journal = {Computers and Fluids}, volume = {18}, year = {1990}, pages = {289--304}, key = {Gropp90 ! performance} } @Article{ foster92, author = {Ian Foster and William Gropp and Rick Stevens}, title = {The parallel scalability of the spectral transform method}, journal = {Monthly Weather Review}, volume = {120}, year = {1992}, pages = {835--850}, key = {Foster92 ! performance} } @InBook{ fgn, author = {R. Freund and G. H. Golub and N. Nachtigal}, title = {Iterative Solution of Linear Systems}, series = {Acta Numerica}, year = {1992}, publisher = {Cambridge University Press}, pages = {57--100} } @TechReport{ nachtigal90, author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, title = {How Fast are Nonsymmetric Matrix Iterations?}, institution = {Massachusetts Institute of Technology}, month = mar, year = {1990}, number = {90-2}, key = {Nachtigal | Krylov} } @Article{ nachtigal1992fnm, title = {How Fast are Nonsymmetric Matrix Iterations?}, author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {13}, pages = {778}, year = {1992}, publisher = {SIAM} } @TechReport{ embree1999descriptive, title = {How descriptive are {GMRES} convergence bounds}, author = {Embree, M.}, year = {1999}, number = {08}, institution = {Oxford University Computing Laboratory} } @Article{ vorst92, author = {H. van der Vorst}, title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution of nonsymmetric linear systems}, journal = {SIAM J. Sci. Stat. Comput.}, year = {1992}, volume = {13}, pages = {631--644} } @Article{ eisenstat81, author = {S. Eisenstat}, title = {Efficient Implementation of a Class of {CG} Methods}, journal = {SIAM J. Sci. Stat. Comput.}, year = {1981}, volume = {2}, pages = {1--4} } @Manual{ ibm-essl, title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and Reference}, organization = {IBM}, year = {1992}, key = {IBM-ESSL} } @Manual{ ibm-eui, title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference Release 2.0}, organization = {IBM}, month = jun, year = {1994}, key = {IBM-EUI} } @Manual{ ibm-euih, title = {Using {EUIH}: An Experimental {EUI} Implementation}, organization = {IBM}, author = {Peter Hochschild}, year = {1993}, key = {IBM-EUIH} } @TechReport{ mpi, title = {Document for a Standard Message-Passing Interface}, author = {Message Passing Interface Forum}, institution = {University of Tennessee}, number = {CS-93-214}, month = nov, year = {1993}, key = {MPI Standard} } @Unpublished{ mpi-final-web, author = {Message Passing Interface Forum}, title = {{MPI}: A Message-Passing Interface Standard}, note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, year = {1994}, month = may } @Book{ hockney-jesshope, author = {R. W. Hockney and C. R. Jesshope}, title = {Parallel Computers 2}, publisher = {Adam Hilger}, year = {1988} } @Book{ cm-fortran, author = {{Thinking Machines Corporation}}, title = {Users Manual for CM-Fortran}, publisher = {Thinking Machines Corporation}, year = {1993} } @TechReport{ chang93, title = {Experiments and Bounds on Block Diagonal Preconditioning}, author = {Mark Yan-Ming Chang and Martin H. Schultz}, institution = {Yale Department of Computer Science}, number = {YALEU/DCS/RR-994}, month = nov, year = {1993}, key = {BDD|diag} } @InProceedings{ gropplevine93, author = {N. Galbreath and W. Gropp and D. Levine}, title = {Applications-Driven Parallel {I/O}}, booktitle = {Proceedings of Supercomputing '93}, year = {1993}, pages = {462--471} } @Book{ siegle85, author = {H. J. Siegel}, title = {Interconnection Networks for Large Scale Parallel Processing}, publisher = {Lexington Books}, year = {1985}, key = {Network Comparison} } @Article{ lawrie75, author = {D. H. Lawrie}, title = {Access and alignment of data in an array processor}, journal = {IEEE Transactions on Computers}, volume = {C-24}, number = {12}, month = dec, year = {1975}, pages = {1145--1155}, key = {Omega Network} } @Book{ knuth1986, title = {The {\TeX}{Book}}, author = {Donald Ervin Knuth and Duane Bibby}, volume = {1993}, year = {1986}, publisher = {Addison-Wesley Reading, Massachusetts} } @Book{ lamport86, author = {Leslie Lamport}, title = {{LaTeX}: A document preparation system}, publisher = {Addison-Wesley}, year = {1986}, key = {Latex Manual} } @InProceedings{ gropp-lusk:unix-tools, author = {William Gropp and Ewing Lusk}, title = {Scalable {U}nix Tools on Parallel Processors}, booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, publisher = {IEEE}, pages = {56--62} } @InProceedings{ jp:bell_prize, author = {Mark Jones and Paul Plassmann}, title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel Applications}, booktitle = {Proceedings of Supercomputing '92}, publisher = {IEEE Computer Society Press}, year = {1992}, pages = {551--560} } @COMMENT{WEB, CWEB references (for doctext)} @TechReport{ web, author = {Donald E. Knuth}, title = {The {\tt WEB} system of structured documentation}, institution = {Computer Science Department, Stanford University}, year = {1983}, number = {980}, month = sep } @Article{ literatepgm, author = {Donald E. Knuth}, title = {Literate Programming}, journal = {Computer Journal}, year = {1984}, volume = {27}, number = {2}, pages = {91--111} } @Unpublished{ cweb-code, author = {Silvio Levy and Donald E. Knuth}, title = {CWEB}, note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} } @Article{ jp:scalable, author = {Mark Jones and Paul Plassmann}, title = {Scalable Iterative Solution of Sparse Linear Systems}, journal = {Parallel Computing}, volume = {20}, number = {5}, month = may, year = {1994}, pages = {753--773} } @Article{ jp:pcolor, author = {Mark T. Jones and Paul E. Plassmann}, title = {A Parallel Graph Coloring Heuristic}, journal = {SIAM J. Sci. Comput.}, volume = {14}, number = {3}, pages = {654-669}, year = {1993} } @TechReport{ block_solve, author = {Mark T. Jones and Paul E. Plassmann}, title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of Sparse Linear Systems}, institution = {Argonne National Laboratory}, year = {1992}, number = {ANL-92/46}, key = {JonesPlassmann92 ! block_solve} } @InProceedings{ supercond, author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications Conference}, month = feb, year = {1994}, key = {McInnesPalumbo94 ! superconductivity } } @Unpublished{ preosti:93, author = {Gianfranco Preosti}, title = { }, note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, year = {1993}, key = {preosti93 ! GL-tilt3d} } @Unpublished{ more:93, author = {Jorge J. Mor\'{e}}, title = { }, note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, {A}rgonne {N}ational {L}aboratory}, year = {1993}, key = {more93 ! MINPACK-2} } @Article{ brownsaad:90, author = {Peter N. Brown and Youcef Saad}, title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, journal = {SIAM J. Sci. Stat. Comput.}, year = {1990}, volume = {11}, pages = {450-481} } @Book{ using-mpi, author = {William Gropp and Ewing Lusk and Anthony Skjellum}, title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, publisher = {MIT Press}, year = {1994} } @Book{ using-mpi2, author = {William Gropp and Ewing Lusk and Rajeev Thakur}, title = {Using MPI 2: Advanced Features of the Message Passing Interface}, publisher = {MIT Press}, year = {1999} } @Article{ hs:52, author = {Magnus R. Hestenes and Eduard Steifel}, title = {Methods of Conjugate Gradients for Solving Linear Systems}, journal = {J. Research of the National Bureau of Standards}, year = {1952}, volume = {49}, pages = {409-436} } @Article{ so:89, author = {Peter Sonneveld}, title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, journal = {SIAM J. Sci. Stat. Comput.}, year = {1989}, volume = {10}, pages = {36-52} } @Article{ v:92, author = {{H. A.} {van der Vorst}}, title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution of nonsymmetric linear systems}, journal = {SIAM J. Sci. Stat. Comput.}, volume = {13}, year = {1992}, pages = {631-644} } @Article{ f:93, author = {Roland W. Freund}, title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear Systems}, journal = {SIAM J. Sci. Stat. Comput.}, volume = {14}, year = {1993}, pages = {470-482} } @Article{ ish:89, author = {S. Ishizuka}, title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, journal = {Combustion and Flame}, volume = {75}, year = {1989}, pages = {367-379} } @Book{ williams89, title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, author = {F.A. Williams}, publisher = {Addison-Wesley}, year = {1989}, pages = {367-379} } @Book{ ra75, author = {R. Aris}, title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, publisher = {Oxford}, year = {1975} } @Book{ bebernes89, author = {J. Bebernes and D. Eberly}, title = {Mathematical Problems from Combustion Theory}, publisher = {Springer-Verlag}, series = {Applied Mathematical Sciences 83}, year = {1989} } @InProceedings{ kikuchi89, author = {F. Kikuchi}, booktitle = { Computing Methods in Applied Sciences and Engineering}, editor = {R. Glowinski and J. L. Lions}, publisher = {Springer-Verlag}, series = {Lecture Notes in Mathematics}, title = {Finite element approximations to bifurcation problems of turning point type}, year = {1977} } @Article{ rg85, author = {R. Glowinski and H.B. Keller and L. Reinhart}, title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of Nonlinear Boundary Problems}, journal = {SIAM J. Sci. Stat. Comput.}, volume = {6}, year = {1985}, pages = {793-832} } @InProceedings{ whitfield91, author = {D. Whitfield and L. Taylor}, title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split Schemes}, booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, misc = {AIAA-91-1539}, pages = {134-145}, year = {1991} } @InProceedings{ quinlan1, author = {M. Lemke and D. Quinlan}, title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for Architecture-Independent Development of Structured Grid Applications}, booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, publisher = {Springer Verlag}, year = {1992} } @InProceedings{ quinlan2, author = {R. Parsons and D. Quinlan}, title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference Computations}, booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, year = {1994} } % ***** Overview of functionality in Diffpack @InBook{ dpoverview, author = {Bruaset, A. M. and Langtangen, H. P.}, booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; {Diffpack}}, publisher = {Birkh{\"{a}}user}, pages = {61--90}, year = {1997} } % ***** Short overview of Diffpack @InCollection{ dpoverview2, author = {Bruaset, A. M. and Langtangen, H. P.}, editor = {A. Sydow}, booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling and Applied Mathematics}, title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, pages = {553--558}, volume = {4}, year = {1997} } % ***** Comprehensive documentation of Diffpack and % associated numerical methods: @Book{ dpbook, author = {H. P. Langtangen}, title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and Software. Part I}, series = {Lecture Notes in Computational Science and Engineering}, publisher = {Springer-Verlag}, year = {1998} } % ***** Design issues of the linear solvers in Diffpack, serves also as a % collection of examples on O-O in numerical computing @Article{ ambhpl97a, author = {A. M. Bruaset and H. P. Langtangen }, title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, journal = {Transactions on Mathematical Software}, volume = {23 }, pages = {50--80}, year = {1997} } @Misc{ dpurl, author = {{Diffpack Web page}}, howpublished = {\url{http://www.diffpack.com}} } % ***** General intro to object-oriented numerics for "FORTRAN programmers" @InCollection{ oonintro, author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, editor = {D{\ae}hlen, M. and Tveito, A.}, booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, title = {Object-Oriented Numerics}, publisher = {Birkh{\"{a}}user}, year = {1997} } % ***** Efficiency comparison: BLAS 1, Diffpack, C, % and finite element applications (F77 vs Diffpack) @InCollection{ dpefficiency, author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, H. P. and Miller, C. T.}, editor = {D{\ae}hlen, M. and Tveito, A.}, booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, title = {On the Efficiency of {C++} in Scientific Computing}, publisher = {Birkh{\"{a}}user}, pages = {91--118}, year = {1997} } % ***** Parallel concept in Diffpack: @InCollection{ dpparallel, author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential Simulators}, publisher = {Springer--Verlag}, series = {Lecture Notes in Computer Science}, pages = {161--168}, year = {1997} } % ***** DD and ML methods in Diffpack: @InCollection{ dpddml, author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, title = {Domain decomposition and multilevel methods in Diffpack}, year = {1997} } @InProceedings{ bsca98, author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David Alexander}, title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear Optimization}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, editor = {Mike Henderson et al.}, pages = {165-173}, year = {1998} } @Book{ scalapack-user-guide, author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. Stanley and D. Walker and R. C. Whaley}, title = {Sca{LAPACK} Users' Guide}, publisher = {SIAM}, address = {Philadelphia, PA}, year = {1997} } @InProceedings{ keyes99, author = {D. E. Keyes}, title = {How Scalable is Domain Decomposition in Practice?}, booktitle = {Proceedings of the 11th International Conference on Domain Decomposition Methods}, editor = {C.-H. Lai et al.}, publisher = {Domain Decomposition Press, Bergen}, note = {To appear}, year = {1999} } @Article{ fun3d, author = {W. K. Anderson and D. L. Bonhaus}, title = {An implicit upwind algorithm for computing turbulent flows on unstructured grids}, journal = {Computers and Fluids}, year = {1994}, volume = {23}, pages = {1--21} } % ------------------------------------------------------------------------- % ------------------------------------------------------------------------- @Article{ torczon, author = {Dennis, Jr., J. E. and V.~Torczon}, title = {Direct Search Methods on Parallel Machines}, journal = {SIAM J. Optimization}, volume = {1}, pages = {448--474}, year = {1991}, key = {Torczon !PDS} } @InProceedings{ wt91, author = {D. L. Whitfield and L. K. Taylor}, title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split Schemes}, booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, misc = {AIAA-91-1539}, pages = {134-145}, year = {1991} } @Article{ ew96, author = {S. C. Eisenstat and H. F. Walker}, title = {Choosing the forcing terms in an inexact {N}ewton method}, journal = {SIAM J. Scientific Computing}, volume = {17}, year = {1996}, pages = {16--32} } @Book{ thi93, author = {{Thinking Machines Corporation}}, title = {Users Manual for CM-Fortran}, publisher = {Thinking Machines Corporation}, year = {1993} } @Book{ mortonmayers94, author = {K. W. Morton and D. F. Mayers}, title = {Numerical Solution of Partial Differential Equations}, publisher = {Press Syndicate of the University of Cambridge}, year = {1994} } @Book{ heath97, author = {Michael T. Heath}, title = {Scientific Computing: An Introductory Survey}, publisher = {McGraw Hill}, year = {1997} } @Article{ captools96, author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and Performance on the Parallelization of Structured Mesh Codes}, journal = {Parallel Computing}, volume = {22}, pages = {197-226}, year = {1996} } @Misc{ nastran-web-page, author = {{MSC Software Corporation}}, title = {{NASTRAN} {W}eb page}, howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, year = {2024} } @Book{ hpf, author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. Zosel}, title = {The High Performance Fotran Handbook}, publisher = {MIT Press}, year = {1994} } @InProceedings{ keyes98, author = {D. E. Keyes}, title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed Architectures}, booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, editors = {M. D. Salas and W. K. Anderson}, ppublisher = {Elsevier}, year = {1998} } @InProceedings{ pooma-atlas, author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and J. V. W. Reynders and M. Tholburn}, title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific Applications}, year = {1995}, month = dec, booktitle = {Supercomputing '95 Proceedings} } % --------------------------------------------------------------------------------- % New bib entries for CRPC paper @Misc{ mgnet-web-page, author = {Craig C. Douglas}, title = {{MGNet Web page}}, note = {See {\tt http://\-www.mgnet.org}} } @Misc{ dagh-web-page, author = {M. Parashar and J. C. Browne}, title = {{DAGH Web page}}, note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} } @Misc{ parasol-web-page, key = {PARASOL}, title = {{PARASOL Web page}}, note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} } @Misc{ pooma-web-page, author = {{POOMA Web page}}, note = {See {\tt http://\-www.acl.lanl.gov/pooma}} } @Misc{ mudpack-web-page, author = {John C. Adams}, title = {{MUDPACK Web page}}, note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} } @Misc{ pellpack-web-page, author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, title = {{Parallel ELLPACK Web page}}, note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} } @InProceedings{ pellpack95, author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. Catlin and S. Weerawarana and T.S. Papatheodorou}, title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, address = {Albuquerque, NM}, year = {1995} } @Misc{ nhse-web-page, author = {{National High-Performance Software Exchange Web page}}, note = {See {\tt http://\-www.nhse.org}} } @Misc{ doug-web-page, author = {Mark J. Hagger and Linda Stals}, title = {{DOUG Web Page}}, note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} } @TechReport{ doug97, author = {Mark J. Hagger}, title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, institution = {Mathematical Sciences, University of Bath}, year = {1997}, number = {9706}, note = {Advances in Computational Mathematics (to appear)} } @Misc{ ug-web-page, author = {{UG Web Page}}, note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} } @Article{ ug97, author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. Rentz-Reichert and C. Wieners}, title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, journal = {Computing and Visualization in Science}, year = {1997}, volume = {}, pages = {} } @Misc{ vecfem-web-page, author = {Lutz Grosz}, title = {{VECFEM Web Page}}, note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} } @Misc{ atlas-web-page, author = {R. Clint {Whaley et al.}}, title = {{ATLAS Web Page}}, howpublished = {\url{http://math-atlas.sourceforge.net}} } @Misc{ fenics-web-page, author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, title = {{FEniCS Web Page}}, note = {\url{http://www.fenicsproject.org}}, year = {2005} } @Misc{ matlab-web-page, author = {{The} {MathWorks}}, title = {{Matlab} {Web} page}, url = {http://www.mathworks.com} } @Misc{ phipac-web-page, author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin and D. Lam}, title = {{PHiPAC Web Page}}, note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} } @InProceedings{ kelp, author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, booktitle = {Irregular '96}, year = {1996} } @Unpublished{ kelp-web-page, author = {Scott Baden}, title = {{KeLP} {W}eb page}, note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} } @InProceedings{ hk99, author = {R. Hornung and S. Kohn}, title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} Framework}, booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable Scientific and Engineering Computing}, pages = {235-244}, year = {1999}, note = {See \url{http://www.llnl.gov/CASC/samrai}} } @Unpublished{ samrai-web-page, title = {{SAMRAI} {W}eb Page}, author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} } @Misc{ overture-web-page, author = {William Henshaw and Kyle Chand}, title = {{Overture} {W}eb page}, howpublished = {\url{http://www.llnl.gov/CASC/Overture}} } @InProceedings{ overture99, author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations on Overlapping Grids}, publisher = {SIAM}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, year = {1999}, pages = {215-224}, note = {See \url{http://www.llnl.gov/CASC/Overture}} } @InProceedings{ diffpack, author = {A.M. Bruaset and H.P. Langtangen}, title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: {D}iffpack}, booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, year = {1997}, pages = {61--90}, publisher = {Birkhauser Press} } @Article{ dongarra:1984:ila, author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline Machine}, journal = {SIAM Review}, volume = {26}, number = {1}, pages = {91--112}, month = jan, year = {1984}, coden = {SIREAD}, issn = {0036-1445 (print), 1095-7200 (electronic)}, mrclass = {65F10 (65F30)}, mrnumber = {85c:65032}, bibdate = {Mon Jan 20 1997}, abstract = {The authors examine common implementations of linear algebra algorithms, such as matrix-vector multiplication, matrix-matrix multiplication and the solution of linear equations. The different versions are examined for efficiency on a computer architecture which uses vector processing and has pipelined instruction execution. By using the advanced architectural features of such machines, one can usually achieve maximum performance, and tremendous improvements in terms of execution speed can be seen over conventional computers.}, classification= {723; 921}, journalabr = {SIAM Rev}, keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; mathematical programming; vector pipeline machine} } @Book{ qv99, author = {Alfio Quarteroni and Alberto Valli}, title = {Domain Decomposition Methods for Partial Differential Equations}, publisher = {Oxford Science Publications}, address = {Oxford}, year = {1999} } @Book{ ksv97, editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, title = {Parallel Numerical Algorithms}, publisher = {Kluwer Academic Publishers}, address = {the Netherlands}, year = {1997} } @Book{ hackbusch94, author = {Wolfgang Hackbusch}, title = {Iterative Solution of Large Sparse Systems of Equations}, publisher = {Springer-Verlag}, address = {New York}, year = {1994} } @Article{ hackbusch1980fast, title = {Fast solution of elliptic control problems}, author = {Hackbusch, W.}, journal = {Journal of Optimization Theory and Applications}, volume = {31}, number = {4}, pages = {565--581}, year = {1980}, publisher = {Springer} } @Book{ hackbusch1985multi, title = {{Multi-grid methods and applications}}, author = {Hackbusch, W.}, isbn = {3540127615}, issn = {0179-3632}, year = {1985}, publisher = {Springer Verlag} } @Book{ axelsson94, author = {Owe Axelsson}, title = {Iterative Solution Methods}, publisher = {Cambridge University Press}, address = {Cambridge}, year = {1994} } @Book{ saad96, author = {Yousef Saad}, title = {Iterative Methods for Sparse Linear Systems}, publisher = {PWS Publishing Company}, address = {Boston}, year = {1996} } @Book{ saad2003, title = {Iterative Methods for Sparse Linear Systems}, author = {Saad, Yousef}, doi = {10.1016/S1570-579X(01)80025-2}, edition = {2nd}, publisher = {SIAM}, year = {2003} } @Book{ vandervorst03, author = {Henk A. {van der Vorst}}, title = {Iterative Krylov Methods for Large Linear Systems}, publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, year = {2003} } @Book{ koniges00, editor = {Alice E. Koniges}, title = {Industrial Strength Parallel Computing}, publisher = {Morgan Kaufmann Publishers}, address = {San Francisco}, year = {2000} } @Misc{ fftw-web-page, key = {Fftw}, title = {{FFTW} {Web} page}, note = {\texttt{http://www.fftw.org/}}, annote = {fast FFT. Parallel versions with MPI and Cilk} } @InProceedings{ frigojohnson93, author = {Matteo Frigo and Steven G. Johnson}, title = {The Design and Implementation of {FFTW3}}, booktitle = {Proceedings of the IEEE}, volume = {93}, number = {2}, pages = {216--231}, year = {2005} } @Book{ kelley95, author = {C. T. Kelley}, title = {Iterative Methods for Linear and Nonlinear Equations}, year = {1995}, publisher = {SIAM}, address = {Philadelphia} } @Unpublished{ spai-web-page, title = {{SPAI} {W}eb {P}age}, note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, author = {Steven Bernard and Marcus Grote}, institution = {NASA Ames Research Center and ETH Zurich} } @Article{ gh97, author = {M. J. Grote and T. Huckle}, title = {Parallel Preconditioning with Sparse Approximate Inverses}, year = {1997}, journal = {SIAM J. of Scient. Comput.}, volume = {18}, pages = {838-853} } @Article{ zhang96, author = {Wen Zhang}, title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the simulation of a sintering process}, year = {1996}, journal = {Appl. Numer. Math.}, volume = {20}, pages = {235-244} } @Article{ zhang98, author = {Wen Zhang and Ian Gladwell}, title = {The sintering of two particles by surface and grain boundary diffusion - a three-dimensional numerical study}, journal = {Comp. Mater. Sci.}, year = {1998}, volume = {12} } @InProceedings{ mollerschwartzbach01, author = {Anders M\o{}ller and Michael I. Schwartzbach}, title = {The Pointer Assertion Logic Engine}, booktitle = {ACM Proceedings of PLDI'01}, year = {2001} } @InProceedings{ klarlandschwartzbach97, author = {Nils Klarland and Michael I. Schwartzbach}, title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, booktitle = {Proceedings of the Conference on Domain-Specific Languages}, publisher = {USENIX}, month = oct, year = {1997}, address = {Santa Barbara, CA} } @InProceedings{ conselmarlet98, author = {C. Consel and R. Marlet}, title = {Architecturing software using a methodology for language development}, booktitle = {Proceedings of the 10th International Symposium on Programming Languages, Implementations, Logics and Programs}, year = {1998}, pages = {170-174}, month = sep, address = {Pisa, Italy} } @Misc{ sundials:homepage, author = {C. {Woodward et al.}}, title = {{SUNDIALS {W}eb page}}, howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} } @article{gardner2022sundials, title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, journal = {ACM Transactions on Mathematical Software (TOMS)}, publisher = {ACM}, year = {2022}, doi = {10.1145/3539801} } @Misc{ sundials-user-ref, title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, note = {See \url{http://www.llnl.gov/CASC/sundials}}, author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban and Dan Shumaker and Carol Woodward}, institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, number = {UCRL-JP-200037}, year = {2003} } @Article{ sundials05, author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker and C. Woodward}, title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, journal = {ACM Transactions on Mathematical Software}, volume = {31}, number = {3}, pages = {363--396}, year = {2005} } @InProceedings{ serban2005cvodes, title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, author = {Serban, Radu and Hindmarsh, Alan C}, booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear Dynamics and Control, Long Beach, CA}, year = {2005} } @Article{ pvode99, author = {G. Byrne and A. Hindmarsh}, title = {{PVODE}, An {ODE} Solver for Parallel Computers}, journal = {Int. J. High Perf. Comput. Apps.}, volume = {13}, number = {4}, year = {1999}, pages = {354 -- 365} } @Article{ cvode95, author = {S. Cohen and A. Hindmarsh}, title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, journal = {Computers in Physics}, volume = {10}, number = {2}, year = {1996}, pages = {138 -- 143} } @TechReport{ ifpack, title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, author = {Marzio Sala and Michael Heroux}, institution = {Sandia National Laboratories}, number = {SAND2005-0662}, year = {2005} } @TechReport{ kinsol-user-ref, title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel Computers}, author = {Allan Taylor and Alan Hindmarsh}, institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, number = {UCRL-ID-131185}, year = {1998} } @Article{ fiardmanteuffelmccormick98, author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: numerical results}, journal = {SIAM J. Sci. Comp.}, year = {1998}, volume = {19}, pages = {1958--1979} } @InProceedings{ vuduc02, author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and Rajesh Nishtala and Benjamin Lee}, title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, booktitle = {Proceedings of Supercomputing}, year = {2002}, month = nov, address = {Baltimore} } @Article{ beckerbraackrannacher1999, title = {Numerical simulation of laminar flames at low Mach number by adaptive finite elements}, author = {Roland Becker and Malte Braack and Rolf Rannacher}, journal = {Combustion Theory and Modelling}, volume = {3}, pages = {503--534}, year = {1999} } @Article{ beckerrannacher01, author = {R. Becker and R. Rannacher}, title = {An optimal control approach to a posteriori error estimation in finite element methods}, journal = {Acta Numerica}, year = {2001}, volume = {10}, pages = {1--102} } @Article{ babuskamiller84a, author = {I. Babu$\check{s}$ka and A.D. Miller}, title = {The post-processing approach in the finite element method, {I}: Calculations of displacements, stresses, and other higher derivatives of the displacements}, journal = {Int. J. Numer. Meth. Eng.}, year = {1984}, volume = {20}, pages = {1085--1109} } @Article{ babuskamiller84b, author = {I. Babu$\check{s}$ka and A.D. Miller}, title = {The post-processing approach in the finite element method, {II}: The calculation of stress intensity factors}, journal = {Int. J. Numer. Meth. Eng.}, year = {1984}, volume = {20}, pages = {1111--1129} } @Article{ babuskamiller84c, author = {I. Babu$\check{s}$ka and A.D. Miller}, title = {The post-processing approach in the finite element method, {III}: A posteriori error estimation and adaptive mesh refinement}, journal = {Int. J. Numer. Meth. Eng.}, year = {1984}, volume = {20}, pages = {2311--2324} } @Unpublished{ jtb-web-page, title = {{The Java Tree Builder}}, note = {See \url{http://www.cs.purdue.edu/jtb}}, author = {Jens Palsberg}, institution = {Purdue University} } @Unpublished{ palsberg98, title = {Why Visitors?}, note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, author = {Jens Palsberg}, institution = {Purdue University}, year = {1998} } @Unpublished{ ply-web-page, title = {{PLY (Python Lex-Yacc)}}, note = {\url{http://systems.cs.chicago.edu/ply}}, author = {David Beazley}, institution = {University of Chicago} } @Misc{ adic-web-page, title = {{ADIC Web page}}, note = {\url{http://www.mcs.anl.gov/autodiff}}, author = {Paul Hovland and Uwe Naumann and Boyana Norris}, institution = {Argonne National Laboratory} } @Article{ naumann02, author = {Uwe Naumann}, title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual computational graph}, journal = {Mathematical Programming (to appear)}, note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, year = {2003} } @Article{ kaper1, author = {H. G. Kaper and T. J. Kaper}, title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, journal = {Physica D}, year = {2002}, pages = {66--93}, volume = {165} } @Misc{ veltisto-web-page, author = {George Biros}, title = {{Veltisto Web page}}, note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} } @Article{ karypiskumar98, author = {George Karypis and Vipin Kumar}, title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix Ordering}, journal = {Journal of Parallel and Distributed Computing}, volume = {48}, pages = {71--85}, year = {1998} } @TechReport{ karypiskumar97, author = {Karypis, George and Kumar, V.}, institution = {Department of Computer Science, University of Minnesota}, keywords = {graph partitioning; ParMetis}, note = {http://www.cs.umn.edu/~metis}, number = {97-060}, title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, year = {1997} } @Misc{ parmetis-web-page, author = {George {Karypis et al.}}, title = {{ParMETIS Web page}}, note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, year = {2005} } @Misc{ sparskit-web-page, author = {Yousef {Saad et al.}}, title = {{SPARSKIT Web page}}, note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} } @Misc{ dscpack-web-page, author = {Padma Raghavan}, title = {{DSCPACK Web page}}, note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} } @Misc{ gaussian-web-page, author = {}, title = {{Gaussian Web page}}, note = {\url{http://gaussian.com}}, key = {{Gaussian} {Web} page} } @Book{ lapack-user-guide, author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, title = {LAPACK Users' Guide, Third Edition}, publisher = {SIAM}, year = {1999} } @Manual{ nwchem4.1, author = {High Performance Computational Chemistry Group}, title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, year = {2002}, organization = {Pacific Northwest National Laboratory}, address = {Richland, Washington 99325-0999 USA}, note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} } @TechReport{ tchem, title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, author = {Cosmin Safta and Habib Najm and Omar Knio}, institution = {Sandia National Laboratories}, number = {SAND2011-3282}, year = {2011} } @Misc{ scidac-web-page, author = {}, title = {{{SciDAC Initiative Web page}}}, note = {\url{http://www.osti.gov/scidac}}, key = {{SciDAC Initiative Web page}} } @Misc{ cmrs:homepage, author = {Amitava {Bhattacharjee (PI)}}, title = {{Center for Magnetic Reconnection Studies}}, howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} } @Misc{ tops:homepage, author = {David {Keyes (PI)}}, title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, howpublished = {\url{http://scalablesolvers.org}} } @Misc{ tstt:homepage, author = {David Brown and Jim Glimm and Lori Freitag}, title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, howpublished = {\url{http://www.tstt-scidac.org}}, year = {2005} } @Misc{ petsc:applications, author = {B. F. {Smith et al.}}, title = {{Scientific Applications Using {PETSc}}}, howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} } @Misc{ petsc:users, author = {B. F. {Smith et al.}}, title = {{PETSc User Statistics}}, howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} } @Misc{ cemm:homepage, author = {Steve {Jardin (PI)}}, title = {{Center for Extended MHD Modeling}}, howpublished = {\url{http://w3.pppl.gov/CEMM}} } @Misc{ m3d:homepage, author = {Steve {Jardin et al.}}, title = {{M3D Web page}}, howpublished = {\url{http://w3.pppl.gov/m3d}} } @Misc{ nimrod:homepage, author = {Carl R. {Sovinec et al.}}, title = {{NIMROD Web page}}, howpublished = {http://nimrodteam.org} } @Misc{ grace-web-page, author = {Manish {Parashar et al.}}, title = {{GrACE Web Page}}, howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} } @Misc{ accel1, title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, author = {K. Ko and R. Ryne (PIs)} } @Unpublished{ katzspiegelman03, author = {Richard F. Katz and Marc Spiegelman}, title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of advection-diffusion problems}, note = {Columbia University, in preparation} } @Misc{ acts:homepage, author = {}, title = {{Advanced CompuTational Software (ACTS) Web page}}, howpublished = {\url{http://acts.nersc.gov}}, key = {{Advanced CompuTational Software (ACTS) Web page}} } @Article{ superlu99, author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and Joseph W. H. Liu}, title = {A supernodal approach to sparse partial pivoting}, journal = {SIAM J. Matrix Analysis and Applications}, year = {1999}, volume = {20}, number = {3}, pages = {720-755} } @Misc{ superlu:homepage, author = {J. Demmel and J. Gilbert and X. Li}, title = {{SuperLU Web page}}, howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} } @InProceedings{ ccf98, author = {E. Chow and A. Cleary and R. Falgout}, title = {Design of the hypre Preconditioner Library}, booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable Scientific and Engineering Computing}, publisher = {SIAM}, year = {1999} } @TechReport{ hypre-users-manual, author = {R. Falgout}, title = {{hypre} Users Manual}, number = {Revision 2.28}, institution = {Lawrence Livermore National Laboratory}, year = {2023}, url = {https://hypre.readthedocs.io/} } @Misc{ hypre:homepage, author = {R. Falgout}, title = {{hypre Web page}}, howpublished = {\url{https://www.llnl.gov/casc/hypre}} } @InProceedings{ trilinos:gpu, author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, title = {A Light-weight API for Portable Multicore Programming}, booktitle = {18th Euromicro International Conference on Parallel, Distributed and Network-Based Processing (PDP)}, pages = {601--606}, publisher = {IEEE}, year = {2010} } @InProceedings{ heroux2004design, title = {The design of {T}rilinos}, author = {Heroux, Michael A and Sala, Marzio}, booktitle = {International Workshop on Applied Parallel Computing}, pages = {620--628}, year = {2004}, organization = {Springer} } @Misc{ trilinos:homepage, author = {M. {Heroux et al.}}, title = {{Trilinos Web page}}, howpublished = {{\tt http://trilinos.sandia.gov/}} } @Article{ trilinos:overview, author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and Kendall S. Stanley}, title = {An overview of the {T}rilinos project}, journal = {ACM Transactions on Mathematical Software}, volume = {31}, number = {3}, year = {2005}, issn = {0098-3500}, pages = {397--423}, publisher = {ACM Press}, doi = {10.1145/1089014.1089021} } @Misc{ rythmos:homepage, author = {T. Coffey and R. Bartlett}, title = {Rythmos: Transient Integration of Differential Equations}, howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} } @Misc{ triangle:homepage, author = {J. {Shewchuk}}, title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, year = {2005} } @Misc{ tetgen:homepage, author = {Hang {Si}}, title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay Triangulator}}, howpublished = {\url{http://tetgen.berlios.de}}, year = {2005} } @Misc{ opencascade:homepage, author = {{OpenCASCADE SAS}}, title = {{Open CASCADE Technology (OCCT)}}, howpublished = {\url{https://dev.opencascade.org/}}, year = {2024} } @Misc{ eigen:homepage, author = {Benoit Jacob and Ga\"el Guennebaud}, title = {{Eigen} {W}eb page}, key = {Jacob}, url = {http://eigen.tuxfamily.org/}, howpublished = {\url{http://eigen.tuxfamily.org/}}, year = {2015} } @Misc{ dune:homepage, author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and Oliver Sander}, title = {{DUNE} {W}eb page}, key = {Bastian}, url = {http://www.dune-project.org/}, howpublished = {\url{http://www.dune-project.org/}}, year = {2015} } @Misc{ thrust, author = {N. Bell and J. Hoberock}, title = {The {T}hrust Library}, howpublished = {{\tt http://code.google.com/p/thrust/}}, year = {2010} } @Misc{ cusp, author = {N. Bell and M. Garland}, title = {The {C}usp Library}, howpublished = {{\tt http://code.google.com/p/cusp-library/}}, year = {2010} } @Misc{ cig:homepage, author = {M. {Gurnis et al.}}, title = {{Computational Infrastructure for Geodynamics}}, howpublished = {\url{http://www.geodynamics.org}} } @Article{ maltsevselkov00, author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and metabolic reconstruction}, journal = {Nucleic Acids Res.}, year = {2000}, month = jan, pages = {123-125}, volume = {28}, number = {1} } @Article{ more:coloring, author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, journal = {SIAM Journal on Numerical Analysis}, year = {1983}, month = feb, pages = {187--209}, volume = {20}, number = {1} } @Article{ selkovmaltsev97, author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence data}, journal = {Gene}, year = {1997}, pages = {GC11-GC26}, volume = {197}, number = {1-2} } @Unpublished{ rocketcenter, title = {Center for Simulation of Advanced Rockets}, note = {http://www.csar.uiuc.edu}, institution = {University of Illinois at Urbana-Champaign} } @Article{ kirby03, title = {A posteriori error estimates for the mixed hybrid finite element method}, author = {Robert C Kirby}, journal = {Computational Geosciences}, volume = {7}, pages = {197--214}, note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, year = {2003} } @Article{ kirby2003b, title = {On the convergence of high resolution methods with multiple time scales for hyperbolic conservation laws}, author = {Robert C Kirby}, journal = {Mathematics of computation}, volume = {72}, number = {243}, pages = {1239--1250}, year = {2003} } @Article{ dawsonkirby2001, title = {High resolution schemes for conservation laws with locally varying time steps}, author = {Clint Dawson and Robert C Kirby}, journal = {SIAM Journal on Scientific Computing}, volume = {22}, number = {6}, pages = {2256--2281}, year = {2001}, publisher = {SIAM} } @Article{ dawsonkirby1999, title = {Solution of parabolic equations by backward Euler-mixed finite element methods on a dynamically changing mesh}, author = {Clint Dawson and Robert C Kirby}, journal = {SIAM Journal on Numerical Analysis}, volume = {37}, number = {2}, pages = {423--442}, year = {1999}, publisher = {SIAM} } @Article{ barthlarson00, author = {T. J. Barth and M. G. Larson}, title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of Hyperbolic Systems}, journal = {LNCS}, year = {2000}, volume = {11}, publisher = {Spinger-Verlag} } @Article{ xu1, author = {J. Xu}, title = {Iterative Methods by Space Decomposition and Subspace Correction}, journal = {SIAM Review}, volume = {34}, pages = {581--613}, year = {1992} } @Article{ brandt77, author = {Achi Brandt}, title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, journal = {Mathematics of Computation}, month = apr, year = {1977}, pages = {333--390}, volume = {31}, number = {138}, doi = {10.2307/2006422} } @Article{ brandt1979multigrid, title = {{Multigrid solutions to elliptic flow problems}}, author = {Brandt, A. and Dinar, N.}, journal = {Numerical Methods for Partial Differential Equations}, pages = {53--147}, year = {1979} } @InCollection{ brandt1979singular, title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, author = {Achi Brandt}, booktitle = {Numerical Analysis of Singular Perturbation Problems}, editor = {Hemker, Pieter W. and Miller, John J.H.}, pages = {53--142}, year = {1979}, publisher = {Academic Press} } @Article{ amge1, author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, journal = {SIAM J. Scientific Computing}, volume = {22}, pages = {1570--1592}, year = {2000} } @Book{ bramble1, author = {J. H. Bramble}, title = {Multigrid Methods}, publisher = {Longman Scientific and Technical}, address = {Essex, England}, year = {1993} } @Book{ arpack98, author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, title = {ARPACK, Users' Guide}, publisher = {SIAM}, year = {1998} } @Article{ bbder96, author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, title = {Algorithmic bombardment for the iterative solution of linear systems: A polyIterative approach}, journal = {J. of Computational and Applied Mathematics}, year = {1996}, volume = {74}, pages = {91--110} } @Article{ egks94, author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, journal = {SIAM J. Scientific Computing}, year = {1994}, volume = {15}, number = {3}, pages = {681--703} } @Article{ dftb02, author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline diamond grain boundaries,}, journal = {Phys. Rev}, year = {2002}, volume = {B65}, pages = {045403} } @InBook{ lsa, author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, title = {The linear system analyzer}, series = {enabling technologies for computational science}, year = {2002}, publisher = {Kluwer}, location = {Dordrecht} } @Article{ kk97, author = {Carl T. Kelley and David E. Keyes}, title = {Convergence analysis of pseudo-transient continuation}, journal = {SIAM J. Numerical Analysis}, year = {1998}, volume = {35}, pages = {508--523} } @Article{ swtm01, author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, journal = {Journal of Computational Physics}, year = {2001}, volume = {172}, number = {2}, pages = {472--514}, title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson Method} } @TechReport{ zhou03, author = {Y. Zhou}, title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, IIGD, RQI and Newton} Updates}, institution = {Argonne National Laboratory}, number = {ANL/MCS-P1074-0803}, note = {Submitted to Numerical Linear Algebra with Applications}, year = {2003} } @Unpublished{ mtwm03, author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, title = {Interpolating moving least squares methods for fitting potential energy surfaces: Detailed analysis of one-dimensional applications}, note = {to appear in the Journal of Chemical Physics}, year = {2003} } @Article{ singhjosephheslaglowinskipan00, author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic particulate flows}, journal = {J. Non-Newtonian Fluid Mech.}, volume = {91}, pages = {165--188}, year = {2000} } @Book{ joseph02, author = {Daniel D. Joseph}, title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, publisher = {Springer-Verlag}, month = mar, year = {2002}, note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} } @Misc{ triangle-web-page, author = {Jonathan R. Shewchuk}, title = {{Triangle Web} page}, note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} } @InCollection{ shewchuk96, author = {Jonathan R. Shewchuk}, title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay Triangulator}, booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, editor = {Ming C. Lin and Dinesh Manocha}, series = {Lecture Notes in Computer Science}, volume = {1148}, publisher = {Springer-Verlag}, pages = {203--222}, month = may, year = {1996}, note = {From the First ACM Workshop on Applied Computational Geometry} } @Article{ leaf1, author = {Transient Dynamics of Pinning of Domain Walls}, title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, journal = {J. Magnetism and Magnetic Materials}, volume = {241}, pages = {118--123}, year = {2002} } @Article{ leaf2, author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of Superconductivity}, journal = {SIAM J. Sci. Comp.}, volume = {23}, pages = {1944--1959}, year = {2002} } @Article{ leaf3, author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, title = {Hysteresis in Layered Spring Magnets}, journal = { Discreet and Continuous Dynamical Systems, Series B}, volume = {1}, pages = {219--232}, year = {2001} } @Article{ leaf4, author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, title = {Rotational Hysteresis of Exchange-Spring Magnets}, journal = {J. Phys. D Appl. Phys.}, volume = {35}, pages = {2339--2343}, year = {2002} } @Article{ leaf5, author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, journal = {Submitted to Phys. Rev. B.}, note = {Submitted}, year = {2003} } @Article{ graysumpternoidbarnes01, author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer Nanospheres}, journal = {Chem. Phys. Lett.}, volume = {333}, pages = {308--313}, year = {2001} } @InProceedings{ petsc-efficient, author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, title = {Efficient Management of Parallelism in Object Oriented Numerical Software Libraries}, booktitle = {Modern Software Tools in Scientific Computing}, editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, publisher = {Birkh{\"{a}}user Press}, pages = {163--202}, year = {1997} } @Article{ mumps01, author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {23}, number = {1}, pages = {15--41}, year = {2001} } @Article{ mumps19, title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on Multicore Architectures}}, author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, journal = {ACM Transactions on Mathematical Software}, volume = {45}, issue = {1}, pages = {2:1--2:26}, year = {2019} } @Article{ zoltan06, author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. \c{C}ataly\"urek and Robert H. Bisseling}, title = {Parallel Hypergraph Partitioning for Irregular Problems}, journal = {SIAM Parallel Processing for Scientific Computing}, month = feb, year = {2006} } @Article{ lidemmel03, author = {Xiaoye S. Li and James W. Demmel}, title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for unsymmetric linear systems}, journal = {ACM Transactions on Mathematical Software}, year = {2003}, month = jun, volume = {29}, number = {2}, pages = {110--140} } @TechReport{ superlu, author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, title = {{SuperLU} Users' Guide}, number = {LBNL-44289}, institution = {Lawrence Berkeley National Laboratory}, year = {2003}, url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} } @TechReport{ trilinos-overview03, title = {{An Overview of {T}rilinos}}, author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James Willenbring and Alan Williams}, institution = {Sandia National Laboratories}, number = {SAND2003-2927}, year = {2003} } @TechReport{ trilinos-users-guide, title = {{Trilinos} Users Guide}, author = {Michael A. Heroux and James M. Willenbring}, institution = {Sandia National Laboratories}, number = {SAND2003-2952}, url = {http://trilinos.sandia.gov/}, year = {2003} } @Article{ pilut01, author = {David Hysom and Alex Pothen}, title = {A scalable parallel algorithm for incomplete factor preconditioning}, journal = {SIAM Journal on Scientific Computing}, volume = {22}, pages = {2194--2215}, year = {2001} } @TechReport{ boomeramg00, author = {V.~E. Henson and U.~M. Yang}, title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, institution = {Lawrence Livermore National Laboratory}, number = {UCRL-JC-133948}, year = {2000} } @InCollection{ baker2012scaling, title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. and Schulz, Martin and Yang, Ulrike Meier}, booktitle = {Competence in High Performance Computing 2010}, pages = {215--226}, year = {2012}, publisher = {Springer} } @Article{ knollkeyes:04, author = {D. A. Knoll and D. E. Keyes}, year = {2004}, title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, journal = {J. Comp. Phys.}, volume = {193}, pages = {357-397} } @Article{ chacon02, author = {Luis Chacon and Dana A. Knoll and John M. Finn}, title = {An implicit nonlinear reduced resistive {MHD} solver}, journal = {J. Comput. Phys}, volume = {188}, year = {2002}, pages = {15--36} } @Article{ mousseau03, author = {V. A. Mousseau and D. A. Knoll}, title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium Radiation Diffusion}, journal = {J. Comput. Physics}, year = {2003} } @Article{ mousseau00, author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium Radiation Diffusion}, journal = {J. Comput. Physics}, year = {2000}, pages = {743--765}, volume = {160} } @Unpublished{ facets:homepage, author = {John {Cary (PI)}}, title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, note = {Proto-FSP project, see \url{http://www.facetsproject.org}} } @Unpublished{ cpes:homepage, author = {{C.S.} {Chang (PI)}}, title = {{Center for Plasma Edge Simulation (CPES)}}, note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} } @Misc{ epsi:homepage, author = {{C.S.} {Chang (PI)}}, title = {{Center for Edge Physics Simulation (EPSI)}}, note = {\url{http://epsi.pppl.gov}} } @Unpublished{ groundwater-scidac2:web, author = {Peter {Lichtner (PI)}}, title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using Advanced Computing}, howpublished = {http://www.scidac.gov/groundwater/gwflow.html} } @Misc{ pflotran:web, author = {Peter {Lichtner (PI)}}, title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using Advanced Computing}}, note = {\url{http://ees.lanl.gov/pflotran/}} } @Misc{ accel-scidac2-solicitation, author = {{DOE Office of Science}}, title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, year = {2006}, note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} } @Article{ nieter04, author = {C. Nieter and J. R. Cary}, title = {{VORPAL}: A Versatile Plasma Simulation Code}, journal = {J. Comp. Phys.}, year = {2004}, volume = {196}, pages = {448} } @Article{ synergia06, author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, title = {Synergia: An accelerator modeling tool with {3-D} space charge}, journal = {J. Comp. Phys.}, year = {2006}, volume = {211}, pages = {229-248} } @Unpublished{ stoltz07, author = {P. H. Stoltz}, title = {Maps of {RF} cavities generated from electromagnetic simulations}, year = {2007}, note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), Albuquerque, NM, 2007} } @Misc{ iter:homepage, key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, year = {2007}, title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, howpublished = {\url{http://www.iter.org}} } @Misc{ epp2010, author = {{Committee on Elementary Particle Physics in the 21st Century, National Research Council}}, title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary Particle Physics}, year = {2006}, howpublished = {The National Academies Press, ISBN: 0309101948} } @Misc{ post-fsp-report, author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen and P.~Colella and S.~C.~Jardin}, title = {{Report of Fusion Simulation Project Steering Committee}}, month = aug, year = {2004}, note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} } @Misc{ fsp:workshop2011, key = {{Fusion Simulation Project (FSP) Planning Workshop}}, title = {{Fusion Simulation Project (FSP) Planning Workshop}}, month = feb, year = {2011}, note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} } @Book{ hazeltine-meiss-book, author = {R.~D.~Hazeltine and J.~D.~Meiss}, title = {Plasma Confinement}, year = {1991}, publisher = {Addison-Wesley, Redwood City, CA} } @Article{ falgout05a, author = {R. D. Falgout and J. E. Jones and U. M. Yang}, title = {Conceptual Interfaces in hypre}, journal = {Future Generation Computer Systems}, note = {Special issue on PDE software}, volume = {22}, year = {2005}, pages = {239--251} } @Article{ falgout05b, author = {R. D. Falgout and J. E. Jones and U. M. Yang}, title = {Pursuing Scalability for hypre's Conceptual Interfaces}, journal = {ACM Trans. Math. Softw.}, volume = {31}, year = {2005}, pages = {326--350} } @Unpublished{ compass:homepage, author = {Panagiotis {Spentzouris (PI)}}, title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} } @Unpublished{ cmsnf:homepage, author = {{Todd Allen, Director}}, title = {{Center for Materials Science of Nuclear Fuel}}, note = {Energy Frontier Research Center, see \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} } @Unpublished{ dvi-materials:project, author = {{L.~C.} {McInnes (PI)}}, title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, note = {{SciDAC}-e project}, year = {2011} } @Misc{ scidac:homepage, author = {{DOE Office of Science}}, title = {{Scientific Discovery through Advanced Computing}}, year = {2007}, howpublished = {\url{http://www.scidac.gov}} } @Misc{ corba, author = {{Object Management Group}}, year = {2007}, title = {{Common Object Request Broker Architecture (CORBA)}}, howpublished = {\url{http://www.corba.org}} } @Article{ uedge, author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in Divertor Tokamak}, journal = {J. Plasma Physics}, year = {1999}, volume = {6}, pages = {1851}, note = {also see user manual at http://www.mfescience.org, then UEDGE link} } @Article{ bout, author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, journal = {J. Plasma Physics}, year = {2000}, volume = {7}, pages = {1951}, note = {} } @Article{ bout++, author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, journal = {Computer Physics Communications}, year = {2009}, volume = {180}, issue = {9}, pages = {1467 -- 1480}, note = {} } @Article{ tempest, author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger and G. Kerbel and W.M. Nevins and T. Rognlien}, title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, journal = {Bull. Am. Phys. Soc. }, year = {2005}, volume = {50}, number = {86}, pages = {CP1}, note = {} } @Article{ ccahpc, author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende and Theresa L. Windus and Shujia Zhou}, title = {A Component Architecture for High-Performance Scientific Computing}, journal = {Intl. J. High-Perf. Computing Appl.}, volume = {20}, pages = {163--202}, year = {2006}, note = {ACTS Collection special issue} } @Misc{ cca-forum:homepage, author = {{Common Component Architecture Forum}}, note = {\url{http://www.cca-forum.org}}, year = {2010} } @Misc{ petsc:driven-cavity-example, title = {{PETSc Driven Cavity Example Code}}, author = {B. F. {Smith et al.}}, howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} } @Misc{ petsc-dm:webpage, author = {B. F. {Smith et al.}}, title = {{PETSc DM Webpage}}, howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, year = {2018} } @Misc{ unic-ref, author = {Giuseppe Palmiotti}, title = {{UNIC} Neutronics Software}, note = {Nuclear Engineering Division, Argonne National Laboratory} } % ----------------------------------------------------------------------- % Model coupling refs @Book{ greve-blatter, author = {Ralf Greve and Heinz Blatter}, title = {Dynamics of Ice Sheets and Glaciers}, series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, publisher = {Springer}, year = {2009} } @Misc{ doe-isicles, key = {ISICLES}, title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} } @Article{ safta2011tchem, title = {TChem-a software toolkit for the analysis of complex kinetic models}, author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, journal = {Sandia Report, SAND2011-3282}, year = {2011} } @Misc{ chemkin-website, key = {chemkin}, title = {ANSYS Chemkin-Pro Website}, howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, year = {2017} } @Misc{ mct-website, key = {MCT}, title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, howpublished = {\url{http://www.mcs.anl.gov/mct}} } @Article{ larson:05, author = {Jay Larson and Robert Jacob and Everest Ong}, title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building Multi-Physics Parallel Coupled Models}, journal = {Int. J. High Perf. Comp. App.}, year = {2005}, pages = {277--292} } @Article{ dennis2012computational, title = {Computational performance of ultra-high-resolution capability in the Community Earth System Model}, author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, journal = {International Journal of High Performance Computing Applications}, volume = {26}, number = {1}, pages = {5--16}, year = {2012}, publisher = {SAGE Publications} } @InProceedings{ bettge01, author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, year = {2001}, title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and Backroads}, booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, pages = {148 -- 156}, series = {Lecture Notes in Computer Science}, volume = {2073}, publisher = {Springer-Verlag} } @InProceedings{ jacob01, author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, year = {2001}, title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, series = {Lecture Notes in Computer Science}, volume = {2073}, publisher = {Springer-Verlag} } @Article{ chen2008new, title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific design}, author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, journal = {Chinese Science Bulletin}, volume = {53}, number = {22}, pages = {3433--3445}, year = {2008}, publisher = {Springer} } @InProceedings{ baum01, author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone and C. Charman}, year = {2001}, title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, series = {Lecture Notes in Computer Science}, volume = {2073}, publisher = {Springer-Verlag} } @InProceedings{ lefantzi03, author = {S. Lefantzi and J. Ray}, year = {2003}, title = {A Component-based Scientific Toolkit for Reacting Flows}, booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, volume = {2}, publisher = {Elsevier} } @Article{ boville98, author = {B. A. Boville and P. R. Gent}, title = {The {NCAR} Climate System Model, Version One}, journal = {Journal of Climate}, volume = {11}, year = {1998}, pages = {1115--1130} } @Misc{ paraschivoiu99, author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, title = {Multi-domain multi-model formulation for compressible flows: Conservative interface coupling and parallel implicit solvers for {3D} unstructured meshes}, note = {AIAA Paper 99-0784}, year = {1999} } @Article{ peszynska, author = {M. Peszynska and M. F. Wheeler and I. Yotov}, title = {Mortar upscaling for multiphysics flow in porous media}, journal = {Computational Geosciences} } @TechReport{ wheeler00, author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, title = {A distributed computing portal for coupling multi-physics and multiple domains in porous media}, institution = {University of Texas at Austin}, number = {TICAM 00-03}, year = {2000} } @TechReport{ peszynska00, author = {M. Peszynska and Q. Lu and M. F. Wheeler}, title = {Multiphysics Coupling of Codes}, institution = {University of Texas at Austin}, number = {TICAM 00-02}, year = {2000} } @Article{ joshaghanijoodatnakshatrala2019, title = {A stabilized mixed discontinuous Galerkin formulation for double porosity/permeability model}, author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {352}, pages = {508--560}, year = {2019} } @InProceedings{ cai99, author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, title = {An explicit multi-model compressible flow formulation based on the full potential equation and the {Euler} equations on {3D} unstructured meshes}, booktitle = {Proceedings of the 11th International Conference on Domain Decomposition Methods}, editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, year = {1999} } @Article{ he05, author = {Yun He and Chris H. Q. Ding}, title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer Architectures}, year = {2005}, volume = {19}, pages = {329--240}, number = {3}, journal = {Int. Journal of High Performance Computing Applications} } @InProceedings{ uiuc-rocket-center02, author = {W. A. Dick and M. T. Heath}, title = {Whole System Simulation of Solid Propellant Rockets}, booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, month = jul, year = {2002} } @InProceedings{ toth04, author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. Oehmke}, title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the Sun-Earth Connection}, year = {2004}, publisher = {Elsevier}, pages = {383--397} } @Misc{ csdrm:web, author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. Shepherd}, title = {{Center for Simulation of Dynamic Response of Materials}}, note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} } @Misc{ csar:web, author = {M. {Heath (Director)}}, title = {{Center for Simulation of Advanced Rockets}}, note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} } @Misc{ csafe:web, author = {D. {Pershing (Director)}}, title = {{Center for Simulation of Accidental Fires and Explosions}}, note = {University of Utah, see \url{http://www.csafe.utah.edu}} } @Misc{ cits:web, author = {P. {Moin (Director)}}, title = {{Center for Integrated Turbulence Simulations}}, note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} } @Misc{ flash:web, author = {D. {Lamb (Director)}}, title = {{Center for Integrated Turbulence Simulations}}, note = {University of Chicago, see \url{http://flash.uchicago.edu}} } @TechReport{ utah-csafe03, author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction Problems, Part 1: Algorithm Development}, institution = {University of Utah, Center for the Simulation of Accidental Fires and Explosions}, year = {2003} } @InBook{ shepherd07, author = {M. Shepherd and E. Seol and B. FrantzDale}, title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, year = {2007}, booktitle = {CRC Handbook of Dynamic System Modeling}, publisher = {Wiley}, pages = {1--41}, note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} } @InProceedings{ cactus02, author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas Radke and Edward Seidel and John Shalf}, title = {The {Cactus} Framework and Toolkit: Design and Applications}, booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, year = {2002}, url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} } @Misc{ cactus:homepage, author = {G. {Allen et al.}}, title = {{Cactus Web page}}, howpublished = {\url{http://cactuscode.org}} } @Misc{ open-grid-forum:web, key = {{Open Grid Forum}}, title = {{Open Grid Forum}}, note = {See \url{http://www.ogf.org}} } @Misc{ nox:web, author = {Tamara Kolda and Roger {Pawlowski et al.}}, title = {Nonlinear Object-Oriented Solutions {(NOX)}}, note = {See \url{http://software.sandia.gov/nox}} } @Misc{ chombo:web, author = {P. {Colella (PI)}}, title = {{Chombo}}, note = {See \url{http://seesar.lbl.gov/anag/chombo}} } @Article{ lanzkron96, author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, title = {An Analysis of Approximate Nonlinear Elimination}, journal = {SIAM J. Sci. Comput.}, volume = {17}, year = {1996}, pages = {538--559} } @Article{ jiang95, author = {J. Jiang and P. Forsyth}, title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} Equations}, journal = {Computers and Fluids}, volume = {24}, pages = {753--770}, year = {1995} } @Article{ young90, author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, journal = {Int. J. Numer. Methods Fluids}, volume = {11}, pages = {1075--1095}, year = {1990} } @Article{ fishwick04, author = {Paul A. Fishwick}, title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach to Interrelating Model Structures}, journal = {SCS Trans. on Simulation}, note = {Special Issue in Grand Challenges in Computer Simulation}, year = {2004} } @Article{ fishwick03, author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, booktitle = {Proceedings of the 2003 Winter Simulation Conference}, editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, year = {2003} } @InProceedings{ kirner00, author = {T. G. Kirner and V. F. Martins}, title = {Development of an Information Visualization Tool Using Virtual Reality}, booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, year = {2000}, pages = {604--606} } @InProceedings{ orso03, author = {A. Orso and J. Jones and M. J. Harrold}, title = {Visualization of Program-Execution Data for Deployed Software}, booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, year = {2003}, pages = {67--76} } @Book{ tiller01, author = {M. Tiller}, title = {Introduction to Physical System Modeling with Modelica}, series = {Kluwer International Series inEngineering and Computer Science}, volume = {615}, publisher = {Kluwer}, year = {2001} } @Article{ buck94, author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, journal = {Int. Journal of Computer Simulation}, volume = {4}, pages = {155--182}, year = {1994} } @Article{ mu95, author = {M. Mu and J.R. Rice}, title = {Modeling with collaborating {PDE} solvers - Theory and practice}, journal = {Comp. Syst. Engr.}, volume = {6}, year = {1995}, pages = {87--95} } @TechReport{ drashansky96, title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, author = {R. Drashansky and A. Joshi and J. R. Rice}, institution = {Emory Universtity, Department of Mathematics and Computer Science}, year = {1996} } @Article{ michopoulos05, title = {Survey on Modeling and Simulation of Multiphysics Systems}, author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, journal = {Journal of Computing and Information Science in Engineering}, volume = {5}, issue = {3}, pages = {198--213}, year = {2005} } @Article{ dubey09, title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel Multiphysics Simulation Code}, author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. Siegel and K. Weide}, journal = {Parallel Computing}, volume = {35}, issue = {10 -- 11}, pages = {512 -- 522}, year = {2009} } @Book{ bottloring95, author = {Raoul Bott and Loring W. Tu}, title = {Differential Forms in Algebraic Topology}, publisher = {Springer}, year = {1995} } @Book{ kobayashinomizu96, author = {Shoshichi Kobayashi and Katsumi Nomizu}, title = {Foundations of Differential Geometry}, publisher = {Wiley-Interscience}, year = {1996} } @Article{ hornungkohn02, author = {Richard D. Hornung and Scott R. Kohn}, title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, journal = {Concurrency and Computation: Practice and Experience}, volume = {14}, pages = {347--368}, year = {2002} } @InProceedings{ concepts06, author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and Gabriel Dos Reis and Andrew Lumsdaine}, title = {Concepts: Linguistic Support for Generic Programming in C++}, booktitle = {Proceedings of OOPSLA 2006}, year = {2006}, pages = {???--???} } @Book{ hatcher02, author = {Hatcher, Allen}, title = {Algebraic Topology}, publisher = {Cambridge University Press}, year = {2002} } @Book{ gammahelmjohnsonvlissides95, abstract = {{Design Patterns is a modern classic in the literature of object-oriented development, offering timeless and elegant solutions to common problems in software design. It describes patterns for managing object creation, composing objects into larger structures, and coordinating control flow between objects. The book provides numerous examples where using composition rather than inheritance can improve the reusability and flexibility of code. Note, though, that it's not a tutorial but a catalog that you can use to find an object-oriented design pattern that's appropriate for the needs of your particular application--a selection for virtuoso programmers who appreciate (or require) consistent, well-engineered object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is more valuable than ever! Use the contents of the CD to create your own design documents and reusable components. The CD contains: 23 patterns you can cut and paste into your own design documents; sample code demonstrating pattern implementation; complete Design Patterns content in standard HTML format, with numerous hyperlinked cross-references; accessed through a standard web browser; Java-based dynamic search mechanism, enhancing online search capabilities; graphical user environment, allowing ease of navigation. First published in 1995, this landmark work on object-oriented software design presents a catalog of simple and succinct solutions to common design problems. Created by four experienced designers, the 23 patterns contained herein have become an essential resource for anyone developing reusable object-oriented software. In response to reader demand, the complete text and pattern catalog are now available on CD-ROM. This electronic version of Design Patterns enables programmers to install the book directly onto a computer or network for use as an online reference for creating reusable object-oriented software. The authors first describe what patterns are and how they can help you in the design process. They then systematically name, explain, evaluate, and catalog recurring designs in object-oriented systems. All patterns are compiled from real-world examples and include code that demonstrates how they may be implemented in object-oriented programming languages such as C++ and Smalltalk. Readers who already own the book will want the CD to take advantage of its dynamic search mechanism and ready-to-install patterns.}}, author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, citeulike-article-id={115158}, howpublished = {Hardcover}, isbn = {0201633612}, keywords = {1995 algorithms architecture book books computer computing design design-pattern design-patterns design_patterns designpatterns development diplom entwurfsmuster four gang gof java mathgamespatterns no-tag object object-orientation object-oriented of oo-patterns oop oriented pattern patterns programming se software software-development software-engineering software_design softwareengineering standard}, month = jan, publisher = {{Addison-Wesley Professional}}, title = {Design Patterns}, url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, year = {1995} } @InProceedings{ chaco95, author = {Bruce Hendrickson and Robert Leland}, title = {A multilevel algorithm for partitioning graphs}, booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing (CDROM)}, year = {1995}, isbn = {0-89791-816-9}, pages = {28}, location = {San Diego, California, United States}, doi = {10.1145/224170.224228}, publisher = {ACM Press}, address = {New York} } @Book{ aleksandrov98, author = {Aleksandrov, Pavel S.}, title = {Combinatorial Topology}, publisher = {Dover}, volume = {3}, year = {1998} } @Book{ steenrod99, abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great importance in modern physics--such as in gauge theory. This book, a succinct introduction to the subject by renown mathematician Norman Steenrod, was the first to present the subject systematically. It begins with a general introduction to bundles, including such topics as differentiable manifolds and covering spaces. The author then provides brief surveys of advanced topics, such as homotopy theory and cohomology theory, before using them to study further properties of fibre bundles. The result is a classic and timeless work of great utility that will appeal to serious mathematicians and theoretical physicists alike. }}, author = {Steenrod, Norman}, citeulike-article-id={712999}, howpublished = {Paperback}, isbn = {0691005486}, keywords = {fibre_bundles topology}, month = apr, publisher = {{Princeton University Press}}, title = {The Topology of Fibre Bundles. (PMS-14)}, url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, year = {1999} } @Book{ bredon97, author = {Bredon, Glen E.}, title = {Sheaf Theory}, publisher = {Springer}, pages = {524}, series = {Graduate Texts in Mathematics}, year = {1997} } @TechReport{ tautgesmeyers04, title = {{MOAB}: A Mesh-Oriented Database}, author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey Ernst}, institution = {Sandia National Laboratories}, number = {SAND2004-1592}, month = apr, year = {2004} } @Article{ tautges04, author = {Timothy J. Tautges}, title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, journal = {Engineering With Computers}, volume = {20}, pages = {286--293}, year = {2004} } @InProceedings{ meyers02, author = {Ray Meyers et. al}, title = {{SNL} Implementation of the {TSTT} Mesh Interface}, booktitle = {8th International conference on numerical grid generation in computational field simulations}, month = jun, year = {2002} } @InProceedings{ seolshepard05, author = {E. S. Seol and Mark S. Shephard}, title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive Analysis}, booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, year = {2005} } @Article{ lishephardbeall2005, title = {3D anisotropic mesh adaptation by mesh modification}, author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, journal = {Computer methods in applied mechanics and engineering}, volume = {194}, number = {48-49}, pages = {4915--4950}, year = {2005}, } @Article{ lushephardtendulkarbeall2014, title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, journal = {Engineering with Computers}, volume = {30}, pages = {271--286}, year = {2014}, } @Article{ beallwalshshephard04, author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, title = {A comparison of techniques for geometry access related to mesh generation}, journal = {Engineering With Computers}, volume = {20}, number = {3}, pages = {210--221}, year = {2004} } @Article{ careyandersoncarneskirk04, author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. Kirk}, title = {Some aspects of adaptive grid technology related to boundary and interior layers}, journal = {Journal of Computational Applied Mathematics}, volume = {166}, number = {1}, pages = {55--86}, year = {2004} } @PhDThesis{ gralthesis, author = {Guntram Berti}, title = {Generic Software Components for Scientific Computing}, school = {TU Cottbus}, year = {2000}, note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} } @Article{ whitehead1949, title = {Combinatorial homotopy. I}, author = {John HC Whitehead}, journal = {Bulletin of the American Mathematical Society}, volume = {55}, number = {3. P1}, pages = {213--245}, year = {1949}, publisher = {American Mathematical Society} } @Article{ beylkincoifmanrokhlin91, author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, journal = {Communications on Pure and Applied Mathematics}, volume = {44}, pages = {141--183}, year = {1991} } @Book{ wesseling92, author = {Pieter Wesseling}, title = {An Introduction to Multigrid Methods}, publisher = {John Wiley and Sons}, year = {1992} } @Book{ grakakos04, author = {Loukas Grakakos}, title = {Classical and Modern Fourier Analysis}, publisher = {Pearson Education}, address = {New Jersey}, year = {2004} } @Misc{ hlib-web-page, key = {HLib}, title = {{HLib} {Web} page}, note = {{\texttt{http://www.hlib.org/}}}, annote = {Hierarchical matrices for fast integral transform} } @Article{ hackbusch99, author = {Wolfgang Hackbusch}, title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: Introduction to {$\mathcal H$}-matrices}, journal = {Computing}, volume = {62}, pages = {89--108}, year = {1999} } @TechReport{ kay1999green, title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes equations}, author = {Kay, D. and Loghin, D.}, year = {1999}, institution = {Oxford University Computing Laboratory}, number = {99/06} } @Article{ bebendorf2003existence, title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of elliptic operators with {$L^\infty$}-coefficients}, author = {Bebendorf, M. and Hackbusch, W.}, journal = {Numerische Mathematik}, volume = {95}, number = {1}, pages = {1--28}, year = {2003}, publisher = {Springer} } @Article{ hackbusch2005direct, title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal H$}-matrix approximation}, author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, journal = {Computing and Visualization in Science}, volume = {8}, number = {3}, pages = {179--188}, year = {2005}, publisher = {Springer} } @TechReport{ duphof2003, author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. Logg and L. R. Scott}, title = {The {FE}ni{CS} project}, institution = {Chalmers Finite Element Center Preprint Series}, number = {2003--21}, year = {2003} } @Article{ flame01, author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de Geijn}, title = {{FLAME}: Formal Linear Algebra Methods Environment}, journal = {Transactions on Mathematical Software}, volume = {27}, number = {4}, year = {2001}, pages = {422--455} } @Article{ puschel05, author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and Nick Rizzolo}, title = {{SPIRAL}: Code Generation for {DSP} Transforms}, journal = {Proceedings of the IEEE}, volume = {93}, number = {2}, year = {2005}, note = {special issue on "Program Generation, Optimization, and Adaptation"} } @Article{ kirbylogg06, author = {Robert C. Kirby and Anders Logg}, title = {A compiler for variational forms}, journal = {ACM Transactions on Mathematical Software}, volume = {32}, number = {3}, year = {2006}, issn = {0098-3500}, pages = {417--444}, doi = {10.1145/1163641.1163644}, publisher = {ACM Press}, address = {New York, NY} } @Article{ kirbylogg07, author = {Robert C. Kirby and Anders Logg}, title = {Efficient compilation of a class of variational forms}, journal = {ACM Transactions on Mathematical Software}, volume = {33}, number = {3}, year = {2007}, issn = {0098-3500}, pages = {17}, doi = {10.1145/1268769.1268771}, publisher = {ACM Press}, address = {New York, NY} } @Article{ bankdupont81, author = {Randolph Bank and Todd Dupont}, title = {An optimal order process for solving finite element equations}, journal = {Mathematics of Computation}, volume = {36}, pages = {35--51}, year = {1981} } @TechReport{ adams00, author = {Mark F. Adams}, title = {Evaluation of three unstructured multigrid methods on 3D finite element problems in solid mechanics}, institution = {UC Berkeley}, number = {CSD-00-1103}, year = {2000}, url = {citeseer.ist.psu.edu/article/adams00evaluation.html} } @Article{ bergengradlhuelsemannruede06, author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, title = {A Massively Parallel Multigrid Method for Finite Elements}, journal = {Computing in Science \& Engineering}, volume = {8}, number = {6}, pages = {56--62}, year = {2006} } @MastersThesis{ brunethesis08, author = {Peter R. Brune}, title = {Enabling Unstructured Multigrid Under the Sieve Framework}, school = {University of Chicago}, address = {Chicago, IL}, year = {2008}, month = feb } @Article{ arnoldwinther02, author = {Douglas N. Arnold and Ragnar Winther}, title = {Mixed finite elements for elasticity}, journal = {Numerische Mathematik}, volume = {92}, number = {3}, month = sep, year = {2002}, pages = {401--419}, doi = {10.1007/s002110100348} } @Article{ arnoldfalkwinther06, author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, title = {Finite element exterior calculus, homological techniques, and applications}, journal = {Acta Numerica}, year = {2006}, volume = {15}, pages = {1--155}, publisher = {Cambridge University Press}, doi = {10.1017/S0962492906210018} } @Article{ kirby04, author = {Robert C. Kirby}, title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis functions}, journal = {ACM Transactions on Mathematical Software}, volume = {30}, number = {4}, year = {2004}, issn = {0098-3500}, pages = {502--516}, doi = {10.1145/1039813.1039820}, publisher = {ACM Press}, address = {New York, NY} } @Article{ kirby06, author = {Robert C. Kirby}, title = {Optimizing {FIAT} with level 3 {BLAS}}, journal = {ACM Transactions on Mathematical Software}, volume = {32}, number = {2}, year = {2006}, issn = {0098-3500}, pages = {223--235}, doi = {10.1145/1141885.1141889}, publisher = {ACM Press}, address = {New York, NY} } @Misc{ bluecrystal08, author = {{B}lue {C}rystal Cluster}, title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, year = {2008}, note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} } @Article{ beylkin95, author = {Gregory Beylkin}, title = {On the Fast Fourier Transform of Functions With Singularities}, journal = {Applied and Computational Harmonic Analysis}, volume = {2}, pages = {363--381}, year = {1995} } @InProceedings{ riehl08, author = {Jonathan Riehl}, title = {Implementing the MyFEM Embedded Domain-specific Language}, booktitle = {Proceedings of the Second International Workshop on Domain-specific Program Development (DSPD'08)}, address = {Nashville, TN}, year = {2008} } @Article{ appel85, author = {Andrew W. Appel}, date-added = {2008-02-27 12:23:39 +0000}, date-modified = {2008-02-27 12:24:02 +0000}, doi = {10.1137/0906008}, journal = {SIAM Journal on Scientific and Statistical Computing}, keywords = {treecodes}, number = {1}, pages = {85-103}, publisher = {SIAM}, title = {An Efficient Program for Many-Body Simulation}, volume = {6}, year = {1985} } @Article{ ewald21, author = {{Ewald}, P.~P.}, title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, journal = {Annalen der Physik}, year = {1921}, volume = {369}, pages = {253-287}, doi = {10.1002/andp.19213690304}, adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, adsnote = {Provided by the SAO/NASA Astrophysics Data System} } @Article{ greengardrokhlin87, author = {L. Greengard and V. Rokhlin}, date-added = {2008-02-15 18:43:55 +0000}, date-modified = {2008-02-26 20:09:11 +0000}, doi = {10.1016/0021-9991(87)90140-9}, journal = {J. Comput.\ Phys.}, keywords = {FMM}, number = {2}, pages = {325--348}, title = {A Fast Algorithm for Particle Simulations}, url = {citeseer.ist.psu.edu/greengard87fast.html}, volume = {73}, year = {1987}, bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} } @Article{ greengardrokhlin97, author = {L. Greengard and V. Rokhlin}, title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three Dimensions}, journal = {Acta Numerica}, volume = {6}, year = {1997}, pages = {229--269} } @Article{ luchenghuangmccammon06, author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular systems}, journal = {PNAS}, doi = {10.1073/pnas.0605166103}, volume = {102}, number = {51}, year = {2006}, pages = {19314--19319} } @Article{ schussnadlereisenberg01, author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel from a molecular model}, journal = {Physical Review E}, volume = {64}, number = {3}, year = {2001} } @Book{ hairerlubichwanner02, author = {E. Hairer and Ch. Lubich and G. Wanner}, title = {Geometric Numerical Integration}, publisher = {Springer-Verlag}, address = {Berlin Heidelberg}, year = {2002} } @Article{ holstbakerwang00, author = {M. Holst and N. Baker and F. Wang}, title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann equation on massively parallel computers}, journal = {Journal of Computational Chemistry}, volume = {21}, year = {2000} } @Book{ hockneyeastwood81, author = {R. Hockney and J. Eastwood}, title = {Computer simulation using particles}, publisher = {McGraw-Hill}, address = {New York}, year = {1981} } @Article{ lutydavistironigunsteren94, author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van Gunsteren}, title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for Calculating Electrostatic Interactions in Periodic Molecular Systems}, journal = {Molecular Simulation}, volume = {14}, number = {1}, year = {1994}, pages = {11--20} } @Book{ briggshensonmccormick00, author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, title = {A Multigrid Tutorial (2nd ed.)}, year = {2000}, isbn = {0-89871-462-1}, publisher = {Society for Industrial and Applied Mathematics}, address = {Philadelphia, PA} } @Article{ chartier2003spectral, title = {Spectral AMGe ($\rho$ AMGe)}, author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and McCormick, S and Ruge, J and Vassilevski, PS}, journal = {SIAM Journal on Scientific Computing}, volume = {25}, number = {1}, pages = {1--26}, year = {2003}, publisher = {SIAM} } @Article{ galvis2010domain, title = {Domain decomposition preconditioners for multiscale flows in high-contrast media}, author = {Galvis, Juan and Efendiev, Yalchin}, journal = {Multiscale Modeling \& Simulation}, volume = {8}, number = {4}, pages = {1461--1483}, year = {2010}, publisher = {SIAM} } @Book{ brennerscott02, author = {Susanne~C. Brenner and L.~Ridgway Scott}, title = {The mathematical theory of finite element methods}, year = {2002}, isbn = {0-38795-451-1}, publisher = {Springer}, pages = {361} } @Book{ trefethenbau97, author = {Lloyd N. Trefethen and David {Bau, III}}, title = {Numerical Linear Algebra}, publisher = {Society for Industrial and Applied Mathematics}, address = {Philadelphia, PA}, pages = {xii + 361}, year = {1997}, isbn = {0-89871-361-7}, isbn-13 = {978-0-89871-361-9}, lccn = {QA184 .T74 1997}, mrclass = {65-01 (65-02 65Fxx)}, mrnumber = {MR1444820 (98k:65002)}, mrreviewer = {Moody T. Chu}, bibdate = {Wed Jan 07 15:23:19 1998}, bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} } @Article{ liptonreagan2014, title = {Quantum Algorithms via Linear Algebra: A Primer}, author = {Richard J Lipton and Kenneth W Regan}, pages = {206}, isbn = {978-0-26202-839-4}, year = {2014} } @InProceedings{ rhea08, author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, booktitle = {Proceedings of IEEE/ACM SC '08}, year = {2008} } @Misc{ bursteddewilcox09, author = {Carsten Burstedde and Lucas~C. Wilcox}, title = {The p4est library: A parallel scalable forest of adaptive octrees}, note = {in preparation} } @Article{ skeeltezcanhardy02, author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, title = {Multiple Grid Methods for Classical Molecular Dynamics}, journal = {J. Comp. Chem.}, volume = {23}, pages = {673--684}, year = {2002} } @Article{ verschelde99, author = {Jan Verschelde}, title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by homotopy continuation}, journal = {ACM Trans. Math. Softw.}, volume = {25}, number = {2}, issn = {0098-3500}, pages = {251--276}, doi = {10.1145/317275.317286}, publisher = {ACM}, address = {New York, NY}, year = {1999} } @InProceedings{ sommeseverscheldewampler08, author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, title = {Solving Polynomial Systems Equation by Equation}, booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, pages = {133--152}, publisher = {Springer-Verlag}, year = {2008} } @Article{ phanthientanner77, author = {N. Phan-Thien and R.~I. Tanner}, title = {A new constitutive equation derived from network theory}, journal = {J. Non-Newt. Fluid Mech.}, volume = {2}, pages = {353}, year = {1977} } @Manual{ sage, key = {SAGE}, author = {W.\thinspace{}A. Stein and others}, organization = {The Sage~Development Team}, title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, note = {{\tt http://www.sagemath.org}}, year = {2009} } @Misc{ bateshauensteinsommesewampler06, author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. Wampler}, title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} } @Article{ archer09, author = {A. J. Archer}, collaboration = {}, title = {Dynamical density functional theory for molecular and colloidal fluids: A microscopic approach to fluid mechanics}, publisher = {AIP}, year = {2009}, journal = {The Journal of Chemical Physics}, volume = {130}, number = {1}, eid = {014509}, numpages = {8}, pages = {014509}, keywords = {colloids; continuum mechanics; density functional theory; free energy; glass transition; statistical distributions; stochastic processes}, doi = {10.1063/1.3054633} } @Article{ giesekus1966, author = {Hanswalter Giesekus}, title = {Die Elastizit\"at von Fl\"ussigkeiten}, journal = {Rheologica Acta}, publisher = {Springer Berlin / Heidelberg}, volume = {5}, number = {1}, month = mar, year = {1966}, doi = {10.1007/BF01973575}, pages = {29-35} } @Article{ baaijens98, author = {F.P. Baaijens}, title = {Mixed finite element methods for viscoelastic flow analysis: a review}, journal = {Journal of Non-Newtonian Fluid Mechanics}, volume = {79}, year = {1998}, pages = {361--385} } @Book{ joseph90, author = {D.~D. Joseph}, title = {Fluid Dynamics of Viscoelastic Liquids}, publisher = {Springer}, address = {New York, NY}, year = {1990} } @Article{ oldroyd50, author = {J.~G. Oldroyd}, title = {On the Formulation of Rheological Equations of State}, journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical Sciences}, volume = {200}, year = {1950}, pages = {523--541} } @InProceedings{ bynasungroppthakur04, author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, year = {2004} } @Book{ pozrikidis07, author = {C. Pozrikidis}, title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, publisher = {Kluwer (Springer)}, pages = {675}, year = {2001}, isbn = {0792373510} } @Misc{ kritzkeyesfsp07, author = {A. Kritz and D. Keyes}, title = {{Fusion Simulation Project Workshop Report}}, month = jul, year = {2007}, note = {Available via \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} } @Misc{ dahlburg02, author = {J. {Dahlburg (Chair)}}, title = {{Final Report of the FESAC ISOFS SubCommittee}}, year = {2002}, note = {Available via \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} } @Misc{ brown08, author = {D. {Brown (Chair)}}, title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View to the Future}}, year = {2008}, howpublished = {Office of Science, U.S. Department of Energy}, url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} } @Misc{ crosscutting10, author = {D. Brown and P. {Messina (Chairs)}}, title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the Exascale}}, year = {2010}, howpublished = {Office of Science, U.S. Department of Energy}, url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} } @Misc{ extreme-scale-solvers-workshop12, author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and L.C. McInnes and E. Ng and S. Wild}, title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future Architectures}, howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, note = {{Washington, DC}, March 8-9, 2012}, url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, year = {2012} } @Misc{ monizrosner09, author = {{E. Moniz and R. Rosner}}, title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling and Simulation at the Extreme Scale}}, month = may, year = {2009}, note = {See \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} } @Misc{ blanford08, author = {{R. Blandord (Chair)}}, title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of Computing at the Extreme Scale}}, month = dec, year = {2008}, note = {See \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} } @Misc{ exascale07, author = {H. Simon and T. Zacharia and R. Stevens}, title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, year = {2007}, note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} } @Misc{ ascrbreakthroughs08, author = {{Panel on Recent Significant Advancements in Computational Science}}, title = {Breakthroughs}, year = {2008}, note = {See \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} } @Misc{ petsc-rd100-2009, author = {{R\&D Magazine}}, title = {{PETSc} {R}\&{D} 100 Award}, year = {2009}, note = {See \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} } @Article{ compass-scidac08, author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and R. Ryne}, title = {Community Petascale Project for Accelerator Science and Simulation: Advancing Computational Science for Future Accelerators and Accelerator Technologies}, journal = {J. Phys.: Conf. Ser.}, volume = {125}, year = {2008}, pages = {012001}, url = {http://iopscience.iop.org/1742-6596/125/1/012001} } @Article{ compass-amundson-scidac08, title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. Stoltz}, journal = {J. Phys.: Conf. Ser.}, volume = {125}, year = {2008} } @InProceedings{ muszala09, title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator Simulations}, author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing {(CBHPC 2009)}}, year = {2009} } @Article{ gaston09, title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear Equations}, author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, journal = {Nuclear Engineering and Design}, volume = {239}, number = {10}, year = {2009}, pages = {1768 -- 1778} } @Article{ gaston09b, title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear Engineering}, author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park and C. Permann and W. Taitano}, journal = {J. Phys.: Conf. Ser.}, volume = {180}, year = {2009}, pages = {012012} } @Article{ newman09, title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen Diffusion in {UO$_2$} Nuclear Fuel Rods}, author = {Chris Newman and Glen Hansen and Derek Gaston}, journal = {Journal of Nuclear Materials}, volume = {392}, issue = {1}, year = {2009}, pages = {6 -- 15} } @Misc{ www:fenics, author = {{FE}ni{CS}}, title = {{FE}ni{CS} Project}, howpublished = {\url{http://www.fenics.org/}}, year = {2018} } @InProceedings{ zwart08, title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical Systems}, author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, booktitle = {Proceedings of ICCS 2008}, year = {2008} } @Article{ klocknerwarburtonbridgehesthaven09, author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, title = {Nodal discontinuous {G}alerkin methods on graphics processors}, journal = {J. Comput. Phys.}, volume = {228}, number = {21}, year = {2009}, issn = {0021-9991}, pages = {7863--7882}, doi = {10.1016/j.jcp.2009.06.041}, publisher = {Academic Press Professional}, address = {San Diego, CA} } @PhDThesis{ rankin99, author = {Rankin, W. T.}, keywords = {FMM, parallel FMM}, school = {Department of Electrical and Computer Engineering, Duke University}, title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, year = {1999} } @InProceedings{ warrensalmon93, abstract = {We report on an efficient adaptive N-body method which we have recently designed and implemented. The algorithm computes the forces on an arbitrary distribution of bodies in a time which scales as N log N with the particle number. The accuracy of the force calculations is analytically bounded, and can be adjusted via a user defined parameter between a few percent relative accuracy, down to machine arithmetic accuracy. Instead of using pointers to indicate the topology of the tree, we identify...}, address = {New York}, author = {Warren, Michael S. and Salmon, John K.}, booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, citeulike-article-id={580952}, keywords = {oct-tree}, pages = {12--21}, publisher = {ACM}, title = {A parallel hashed Oct-Tree {N}-body algorithm}, year = {1993}, doi = {10.1145/169627.169640}, url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} } @Unpublished{ cruzwccm10, author = {Felipe A. Cruz}, title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, note = {Presentation at WCCM 2010, Sydney Australia}, year = {2010} } @Article{ mcguffee06, author = {S.~R. {McGuffee} and A.~H. Elcock}, title = {Atomistically detailed simulations of concentrated protein solutions: the effects of salt, {pH}, point mutations, and protein concentration in simulations of 1000-molecule systems}, journal = {Journal of the American Chemical Society}, volume = {128}, pages = {12098--12110}, year = {2006} } @Article{ nilsencaihoylandlangtangen10, author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach in Python}}, journal = {ArXiv e-prints}, archiveprefix = {arXiv}, eprint = {1002.0705}, primaryclass = {cs.DC}, keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science - Programming Languages}, year = {2010}, month = feb, adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, adsnote = {Provided by the SAO/NASA Astrophysics Data System} } @Misc{ mcinnes:siam09:minisymposium, title = {Implicit Nonlinear Solvers in Multimodel Simulations}, author = {L. C. McInnes and C. {Woodward (co-organizers)}}, note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at Austin).} } @Misc{ mcinnes:fsp-summary:feb2011, author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, title = {Solvers and Time Integration Breakout Summary}, note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} } @Misc{ dvi-materials:siamcse11, title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. Smith and L. Wang}, note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science and Engineering, March 3, 2011} } @Misc{ jamroz:cemm10, title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, author = {B. Jamroz and S. Kruger and T. Austin}, note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} } @Misc{ kruger:feb4-2011, title = {personal communication}, author = {S. Kruger}, note = {February, 2011} } @Article{ elman1996, author = {H.C. Elman}, title = {Preconditioning for the steady-state {Navier-Stokes} equations for low viscosity}, journal = {SIAM J. Sci. Comput.}, volume = {20}, year = {1996}, pages = {1299--1316} } @Article{ kayloghinwathen2002, author = {D. Kay and D. Loghin and A. Wathen}, title = {A preconditioning for the steady-state {Navier-Stokes} equations}, journal = {SIAM J. Sci. Comput.}, volume = {24}, year = {2002}, pages = {237--256} } @Article{ elmanhowleshadidshuttleworthtuminaro2006, author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, title = {Block preconditioners based on approximate commutators}, journal = {SIAM J. Sci. Comput.}, volume = {27}, number = {5}, year = {2006}, pages = {1651--1668} } @Article{ braesssarazin1997, author = {Dietrich Braess and Regina Sarazin}, title = {An efficient smoother for the {Stokes} problem}, journal = {Applied Numerical Mathematics}, volume = {23}, number = {1}, year = {1997}, pages = {3--19}, doi = {10.1016/S0168-9274(96)00059-1} } @Article{ wright2001large, title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, author = {Wright, T.G. and Trefethen, L.N.}, journal = {SIAM Journal on Scientific Computing}, volume = {23}, pages = {591}, year = {2001} } @Misc{ wright2002eigtool, title = {Eig{T}ool}, author = {Wright, T.G. and Trefethen, LN}, howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, year = {2002} } @Misc{ visit-web-site, key = {{VisIt}}, title = {{VisIt web site}}, howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, url = {http://wci.llnl.gov/codes/visit/}, year = {2011} } @Book{ trefethen1996, title = {Finite difference and spectral methods for ordinary and partial differential equations}, author = {Lloyd Nicholas Trefethen}, year = {1996}, publisher = {Cornell University-Department of Computer Science and Center for Applied Mathematics} } @Book{ trefethen2005spectra, title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, author = {Trefethen, L.N. and Embree, M.}, year = {2005}, publisher = {Princeton University Press} } @Article{ gomez2010isogeometric, title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {199}, number = {25-28}, pages = {1828--1840}, issn = {0045-7825}, year = {2010}, publisher = {Elsevier} } @Article{ gomez2008isogeometric, title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {197}, number = {49-50}, pages = {4333--4352}, year = {2008}, publisher = {Elsevier} } @Misc{ fastmath:project, author = {Lori {Diachin (PI)}}, title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics (FASTMath) Institute}}, howpublished = {\url{https://fastmath-scidac.llnl.gov}} } @Misc{ exascale-software:proposal, author = {Peter {Beckman (PI)}}, title = {{Exascale Software Center}}, note = {proposal to DOE} } @Misc{ imex:project, author = {Barry {Smith (PI)}}, title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent Multimodel PDEs}}, note = {DOE ASCR applied math project} } @Misc{ intel-mic:website, author = {Intel}, title = {{Many Integrated Core Architecture}}, note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} } @Article{ dudson:2009, author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, journal = {Computer Physics Communications}, volume = {180}, pages = {1467}, year = {2009} } @Article{ umansky:2009, author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, title = {{Status and verification of edge plasma turbulence code BOUT}}, journal = {Computer Physics Communications}, year = {2009}, volume = {180}, pages = {887-903} } @Article{ xu:1998, author = {X.Q. Xu and R.H. Cohen}, title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, journal = {Computer Physics Communications}, year = {1998}, volume = {36}, number = {1-2}, pages = {158} } @Article{ tron:1999, title = {Newton's Method for Large Bound-constrained Optimization Problems}, author = {Chih-Jen Lin and Jorge Mor\'{e}}, journal = {SIAM Journal on Optimization}, volume = {9}, number = {4}, pages = {1100-1127}, year = {1999} } @Article{ stubenamg, author = {K. St\"{u}ben}, title = {A review of algebraic multigrid}, journal = {J. Comput. Appl. Math.}, volume = {128}, number = {1-2}, year = {2001}, issn = {0377-0427}, pages = {281--309}, doi = {10.1016/S0377-0427(00)00516-1}, publisher = {Elsevier Science Publishers B. V.}, address = {Amsterdam, The Netherlands, The Netherlands} } @Article{ feuchtermg, author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, title = {Bridging the gap between geometric and algebraic multigrid methods}, journal = {Computing and visualization in science}, publisher = {Springer}, volume = {6}, number = {1}, year = {2003}, pages = {1--13} } @Article{ chowmgsmoothness, abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that only attempts to interpolate in the directions of geometrical smoothness. These directions are determined by analyzing samples of algebraically smooth error, e. Neighboring grid points i and j are called smoothly coupled if e i and e j are consistently nearby in value. In addition, these dierences may be used to dene interpolation weights. These new ideas may be incorporated into the algebraic multigrid method. Test results show that the new method can have much lower grid and operator complexities compared to AMG, leading to lower solve timings. 1 }, author = {Chow, Edmond}, citeulike-article-id={7675372}, citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, journal = {American Journal of Mathematics}, keywords = {fem, multigrid}, pages = {197--215}, posted-at = {2010-08-17 23:29:51}, priority = {2}, title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, volume = {65}, year = {2001} } @Article{ jonesamge, abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite elements) method based on element agglomeration. In the method, coarse grid elements are formed by agglomerating fine grid elements. Compatible interpolation operators are constructed which yield coarse grid basis functions with a minimal energy property. Heuristics based on interpolation quality measures are used to guide the agglomeration procedure. The performance of the resulting method is demonstrated in two-level numerical experiments.}}, author = {Jones, Jim E. and Vassilevski, Panayot S.}, citeulike-article-id={8598569}, citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, journal = {SIAM Journal on Scientific Computing}, keywords = {amg, fem, multigrid}, number = {1}, pages = {109--133}, posted-at = {2011-01-13 18:05:55}, priority = {2}, publisher = {SIAM}, title = {{AMGE Based on Element Agglomeration}}, url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, volume = {23}, year = {2001} } @Article{ saad1993, author = {Saad, Youcef}, doi = {10.1137/0914028}, issn = {10648275}, journal = {SIAM Journal on Scientific Computing}, keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of precondition-,preconditioned conju-,subject classi cations,variable preconditioners}, number = {2}, pages = {461--469}, title = {{A flexible inner-outer preconditioned GMRES algorithm}}, volume = {14}, year = {1993} } @Misc{ path:homepage, author = {S. Dirkse and M. Ferris and T. Munson}, title = {{{PATH} {W}eb page}}, howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} } @Article{ ketcheson2008, author = {David I Ketcheson}, title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with Low-Storage Implementations}, volume = {30}, journal = {SIAM Journal on Scientific Computing}, year = {2008}, pages = {2113--2136} } @Article{ elman2009boundary, title = {{Boundary conditions in approximate commutator preconditioners for the Navier-Stokes equations}}, author = {Elman, H.C. and Tuminaro, R.}, journal = {Electronic Transactions on Numerical Analysis}, volume = {35}, pages = {257--280}, year = {2009} } @Article{ elman2008tcp, title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the incompressible Navier-Stokes equations}}, author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, journal = {Journal of Computational Physics}, volume = {227}, number = {1}, pages = {1790--1808}, year = {2008}, publisher = {Academic Press}, url = {https://www.osti.gov/biblio/920807/} } @Article{ arioli2013, title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, author = {Arioli, Mario}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {34}, number = {2}, pages = {571--592}, year = {2013}, publisher = {SIAM} } @Book{ wesseling2009, title = {Principles of computational fluid dynamics}, author = {Wesseling, Pieter}, volume = {29}, year = {2009}, publisher = {Springer Science \& Business Media} } @Article{ silvester2001efficient, title = {{Efficient preconditioning of the linearized Navier-Stokes equations for incompressible flow}}, author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, journal = {Journal of Computational and Applied Mathematics}, volume = {128}, number = {1-2}, pages = {261--279}, issn = {0377-0427}, year = {2001}, publisher = {Elsevier} } @Article{ elman1999bfbt, title = {{Preconditioning for the steady-state Navier-Stokes equations with low viscosity}}, author = {Elman, H.C.}, journal = {SIAM Journal on Scientific Computing}, volume = {20}, number = {4}, pages = {1299--1316}, issn = {1064-8275}, year = {1999}, publisher = {Citeseer} } @Article{ elman2006bpb, title = {{Block preconditioners based on approximate commutators}}, author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, journal = {SIAM Journal on Scientific Computing}, volume = {27}, number = {5}, pages = {1651--1668}, year = {2006}, publisher = {Philadelphia, PA: SIAM, c1993-} } @Article{ olshanskii2006analysis, title = {{Analysis of a Stokes interface problem}}, author = {Olshanskii, M.A. and Reusken, A.}, journal = {Numerische Mathematik}, volume = {103}, number = {1}, pages = {129--149}, issn = {0029-599X}, year = {2006}, publisher = {Springer} } @Article{ patankar1972cph, title = {{A calculation procedure for heat, mass and momentum transfer in three-dimensional parabolic flows}}, author = {Patankar, S.V. and Spalding, D.B.}, journal = {Int. J. Heat Mass Transfer}, volume = {15}, pages = {1787--1806}, year = {1972} } @Article{ rannacher1992simple, title = {{Simple nonconforming quadrilateral Stokes element}}, author = {Rannacher, R. and Turek, S.}, journal = {Numerical Methods for Partial Differential Equations}, volume = {8}, number = {2}, pages = {97--111}, issn = {1098-2426}, year = {1992}, publisher = {Wiley Online Library} } @Article{ rannacher2000finite, title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, author = {Rannacher, R.}, journal = {Fundamental Directions in Mathematical Fluid Mechanics}, pages = {191}, isbn = {3764364149}, year = {2000}, publisher = {Birkhauser} } @Article{ vanka1986block, title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive variables}}, author = {Vanka, S.P.}, journal = {Journal of Computational Physics}, volume = {65}, number = {1}, pages = {138--158}, issn = {0021-9991}, year = {1986}, publisher = {Elsevier} } @Article{ eisenstat1983variational, title = {Variational iterative methods for nonsymmetric systems of linear equations}, author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, journal = {SIAM Journal on Numerical Analysis}, volume = {20}, number = {2}, pages = {345--357}, year = {1983}, publisher = {JSTOR} } @InProceedings{ burstedde2008scalable, title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, T. and Wilcox, L.C. and Zhong, S.}, booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, pages = {62}, year = {2008}, organization = {IEEE Press} } @Article{ burstedde2009parallel, title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} flow problems}, author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {198}, number = {21-26}, pages = {1691--1700}, year = {2009}, publisher = {Elsevier} } @Article{ stadler2010dynamics, title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and Ghattas, O.}, journal = {Science}, volume = {329}, number = {5995}, pages = {1033}, year = {2010}, publisher = {American Association for the Advancement of Science} } @Article{ tackley2008modelling, title = {Modelling compressible mantle convection with large viscosity contrasts in a three-dimensional spherical shell using the yin-yang grid}, author = {Tackley, P.J.}, journal = {Physics of the Earth and Planetary Interiors}, volume = {171}, number = {1-4}, pages = {7--18}, year = {2008}, publisher = {Elsevier} } @Article{ moresizhonggurnis96, author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying viscosity}, journal = {Physics of the Earth and Planetary Interiors}, volume = {97}, pages = {83-–94}, year = {1996} } @Article{ moresisolomatov95, author = {Louis N. Moresi and V. S. Solomatov}, title = {Numerical investigation of {2D} convection with extremely large viscosity variations}, journal = {Physics of Fluids}, volume = {7}, number = {9}, pages = {2154-–2162}, year = {1995} } @Article{ chenmolnar83, author = {W.-P. Chen and P. Molnar}, title = {Focal depths of intra-continental and intraplate earthquakes and their implications for the thermal and mechanical properties of the lithosphere}, journal = {Journal of Geophysical Research}, volume = {88}, pages = {4183–-4214}, year = {1983} } @Article{ jackson02, author = {J. Jackson}, title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, journal = {GSA Today}, volume = {12}, pages = {4–-10}, year = {2002} } @Article{ burovwatts06, author = {E.B. Burov and A.B. Watts}, title = {The long-term strength of continental lithosphere: jelly sandwich or creme brulee?}, journal = {GSA Today}, volume = {16}, pages = {4–-10}, year = {2006} } @InProceedings{ yang:brent:2002, title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on Parallel Distributed Memory Architectures}, author = {Laurence T. Yang and Richard Brent}, booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures for Parallel Processing}, year = {2002}, publisher = {IEEE} } @Article{ demmel2008communication, title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, journal = {Arxiv preprint arXiv:0808.2664}, year = {2008} } @Article{ demmel09, author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, title = {Communication-optimal Iterative Methods}, journal = {Journal of Physics: Conf. Series}, volume = {180}, year = {2009} } @TechReport{ parms04, author = {Yousef Saad and Masha Sosonkina}, title = {{pARMS}: A package for the parallel iterative solution of general large sparse linear systems user's guide}, number = {UMSI2004-8}, institution = {Minnesota Supercomputer Institute, University of Minnesota}, year = {2004} } @Article{ picard1890, author = {Emile Picard}, title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la m\'ethode des approximations successives}, journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, volume = {4}, number = {6}, pages = {145--210}, year = {1890}, url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} } @Book{ rall1969, author = {Louis B. Rall}, title = {Computational solution of nonlinear operator equations}, publisher = {Krieger Pub Co.}, pages = {225}, year = {1969} } @Article{ fletcherreeves1964, author = {R. Fletcher and C. M. Reeves}, title = {Function Minimization by Conjugate Gradients}, journal = {Computer Journal}, volume = {7}, pages = {149–-154}, year = {1964} } @InBook{ mcinnesallanetal06, author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, editor = {A.~M.~Bruaset and A.~Tveito}, title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, publisher = {Springer}, year = {2006}, number = {51}, series = {Lecture Notes in Computational Science and Engineering}, pages = {327--381}, doi = {10.1016/S0167-8191(02)00191-6} } @Article{ cyrshadidtuminaro12, title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} equations}, journal = {Journal of Computational Physics}, volume = {231}, number = {2}, pages = {345 - 363}, year = {2012}, issn = {0021-9991}, doi = {10.1016/j.jcp.2011.09.001}, author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} } @Article{ keyesmcinneswoodwardetal13, title = {Multiphysics Simulations: Challenges and Opportunities}, author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, journal = {International Journal of High Performance Computing Applications}, month = feb, year = {2013}, volume = {27}, number = {1}, pages = {4--83}, doi = {10.1177/1094342012468181}, note = {Special issue}, abstract = {We consider multiphysics applications from algorithmic and architectural perspectives, where ``algorithmic'' includes both mathematical analysis and computational complexity and ``architectural'' includes both software and hardware environments. Many diverse multiphysics applications can be reduced, en route to their computational simulation, to a common algebraic coupling paradigm. Mathematical analysis of multiphysics coupling in this form is not always practical for realistic applications, but model problems representative of applications discussed herein can provide insight. A variety of software frameworks for multiphysics applications have been constructed and refined within disciplinary communities and executed on leading-edge computer systems. We examine several of these, expose some commonalities among them, and attempt to extrapolate best practices to future systems. From our study, we summarize challenges and forecast opportunities.} } @Misc{ rosner10, author = {Robert {Rosner (Chair)}}, title = {{The Opportunities and Challenges of Exascale Computing}}, year = {2010}, howpublished = {Office of Science, U.S. Department of Energy}, url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} } @Misc{ kogge2008exascale, title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, howpublished = {DARPA}, year = {2008}, url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} } @Misc{ doegrandchallengeworkshops, key = {Office of Science, U.S. Department of Energy}, title = {{Scientific Grand Challenges Workshop Series}}, howpublished = {Office of Science, U.S. Department of Energy, see \url{http://extremecomputing.labworks.org/workshops.stm}} } @Misc{ lawrence2011, key = {Lawrence}, title = {{Ernest Orlando Lawrence Award Winners}}, howpublished = {U.S. Department of Energy, {\footnotesize \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, year = {2011} } @Article{ murphy2000npi, title = {{A note on preconditioning for indefinite linear systems}}, author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, journal = {SIAM Journal on Scientific Computing}, volume = {21}, number = {6}, pages = {1969--1972}, year = {2000}, publisher = {Philadelphia, PA: SIAM, c1993-} } @Article{ elman2011bouyancy, title = {Fast iterative solvers for buoyancy driven flow problems}, journal = {Journal of Computational Physics}, volume = {230}, number = {10}, pages = {3900 - 3914}, year = {2011}, note = {}, issn = {0021-9991}, doi = {10.1016/j.jcp.2011.02.014}, author = {Howard Elman and Milan Mihajlovic and David Silvester}, keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, Adaptivity, Preconditioning, Algebraic multigrid} } @Article{ dongarrabeckman11, author = {J. Dongarra and P. Beckman and et al.}, title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, journal = {Int. J. High Perf. Comput. Applics.}, volume = {25}, year = {2011}, pages = {3--60} } @Article{ mandel1999energy, title = {Energy optimization of algebraic multigrid bases}, author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, journal = {Computing}, volume = {62}, number = {3}, pages = {205--228}, year = {1999}, publisher = {Springer} } @Article{ vanek1996algebraic, title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic problems}, author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, journal = {Computing}, volume = {56}, number = {3}, pages = {179--196}, year = {1996}, publisher = {Springer} } @Article{ vanek2001convergence, title = {Convergence of algebraic multigrid based on smoothed aggregation}, author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, journal = {Numerische Mathematik}, volume = {88}, number = {3}, pages = {559--579}, year = {2001}, publisher = {Springer} } @Article{ brannick2007algebraic, title = {Algebraic multigrid methods based on compatible relaxation and energy minimization}, author = {Brannick, J. and Zikatanov, L.}, journal = {Domain decomposition methods in science and engineering XVI}, pages = {15--26}, year = {2007}, publisher = {Springer} } @Article{ brannickfalgout2010, title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, author = {James J. Brannick and Robert D. Falgout}, journal = {SIAM Journal on Scientific Computing}, volume = {32}, number = {3}, pages = {1393--1416}, url = {http://epubs.siam.org/doi/10.1137/090772216}, doi = {10.1137/090772216}, issn = {1064-8275}, year = {2010} } @Article{ xu2004energy, title = {On an energy minimizing basis for algebraic multigrid methods}, author = {Xu, J. and Zikatanov, L.}, journal = {Computing and Visualization in Science}, volume = {7}, number = {3}, pages = {121--127}, year = {2004}, publisher = {Springer} } @Article{ dblp:journals/toms/bakerhlt09, author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, journal = {ACM Trans. Math. Softw.}, volume = {36}, number = {3}, year = {2009}, doi = {10.1145/1527286.1527287}, bibsource = {DBLP, http://dblp.uni-trier.de} } @Article{ dblp:journals/siamsc/yanggbllhn05, author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and Parry Husbands and Esmond G. Ng}, title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, journal = {SIAM J. Scientific Computing}, volume = {27}, number = {3}, year = {2005}, pages = {873-892}, doi = {10.1137/040613767}, bibsource = {DBLP, http://dblp.uni-trier.de} } @TechReport{ ml-guide, author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, title = {{ML} 5.0 Smoothed Aggregation User's Guide}, institution = {Sandia National Laboratories}, year = {2006}, number = {SAND2006-2649} } @Article{ brannick06, title = {An energy-based AMG coarsening strategy}, volume = {13}, doi = {10.1002/nla.480}, number = {2-3}, journal = {Numerical Linear Algebra with Applications}, author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S and Ruge, J}, year = {2006}, pages = {133--148} } @Article{ olson10, author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, title = {A new perspective on strength measures in algebraic multigrid}, journal = {Numerical Linear Algebra with Applications}, volume = {17}, number = {4}, pages = {713--733}, year = {2010}, publisher = {John Wiley \& Sons, Ltd.}, issn = {1099-1506}, doi = {10.1002/nla.669} } @Article{ olson11, author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy Minimization}, journal = {SIAM J. Sci. Comput.}, issue_date = {April 2011}, volume = {33}, issue = {2}, month = apr, year = {2011}, issn = {1064-8275}, pages = {966--991}, numpages = {26}, doi = {10.1137/100803031}, acmid = {2078825}, publisher = {Society for Industrial and Applied Mathematics}, address = {Philadelphia, PA}, keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed aggregation} } @Article{ dorit2011, author = {Dorit Ron and Ilya Safro and Achi Brandt}, title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, journal = {Multiscale Modeling {\&} Simulation}, volume = {9}, number = {1}, year = {2011}, pages = {407-423}, doi = {10.1137/100791142} } @Article{ chen2011algebraic, title = {Algebraic distance on graphs}, author = {Chen, Jie and Safro, Ilya}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {6}, pages = {3468--3490}, year = {2011}, publisher = {SIAM} } @InProceedings{ adams04, author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, title = {Ultrascalable implicit finite element analyses in solid mechanics with over a half a billion degrees of freedom}, note = {Gordon Bell Award}, year = {2004} } @Article{ adams03a, author = {Adams, M.~F.}, journal = {Numerical Linear Algebra with Applications}, number = {2-3}, pages = {141-153}, title = {Algebraic multigrid methods for constrained linear systems with applications to contact problems in solid mechanics}, volume = {11}, year = {2004} } @Article{ adams-10a, author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, doi = {10.1016/j.jcp.2010.04.024}, issn = {0021-9991}, journal = {Journal of Computational Physics}, keywords = {Implicit magnetohydrodynamics}, number = {18}, pages = {6208 - 6219}, title = {Toward textbook multigrid efficiency for fully implicit resistive magnetohydrodynamics}, volume = {229}, year = {2010} } @InProceedings{ adams98, address = {Copper Mountain, CO}, author = {Adams, M.~F.}, booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, title = {A Parallel Maximal Independent Set Algorithm}, year = {1998} } @InProceedings{ madaypatera89, author = {Y. Maday and A. T. Patera}, title = {Spectral element methods for the {Navier-Stokes} equations}, editor = {A. K. Noor and J. T. Oden}, booktitle = {State-of-the-Art Surveys in Computational Mechanics}, pages = {71-–143}, publisher = {ASME}, address = {New York, NY}, year = {1989} } @Article{ mishra2012mlmcfvm, title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of conservation laws in multi-dimensions}, journal = {Journal of Computational Physics}, volume = {231}, number = {8}, pages = {3365--3388}, year = {2012}, issn = {0021-9991}, doi = {10.1016/j.jcp.2012.01.011}, author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte Carlo, Parallelization} } @Article{ barth2011mlmcfe, author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, Switzerland}, title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with stochastic coefficients}, journal = {Numerische Mathematik}, publisher = {Springer Berlin / Heidelberg}, issn = {0029-599X}, keyword = {Mathematics and Statistics}, pages = {123-161}, volume = {119}, issue = {1}, doi = {10.1007/s00211-011-0377-0}, year = {2011} } @Article{ nguyen2011hybridizable, title = {Hybridizable discontinuous {G}alerkin methods}, author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, journal = {Spectral and High Order Methods for Partial Differential Equations}, pages = {63--84}, year = {2011}, publisher = {Springer} } @Misc{ snyder-scidac3:proposal, author = {Philip {Snyder (PI)}}, title = {{Plasma Edge Advanced Computation (PEAC) Center}}, note = {proposal to DOE SciDAC3}, month = oct, year = {2011} } @Misc{ wirth-scidac3:proposal, author = {Brian {Wirth (PI)}}, title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier through Leadership Class Computing}}, note = {proposal to DOE SciDAC3}, month = oct, year = {2011} } @Misc{ cary-scidac3:proposal, author = {John {Cary (PI)}}, title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak Stability (IMMPACTS)}}, note = {proposal to DOE SciDAC3}, month = oct, year = {2011} } @Misc{ vashista-scidac3:proposal, author = {Priya {Vashista (PI)}}, title = {{Design of Damage-Tolerance Material Interfaces for Extreme Stress-Temperature-Corrosion Environments: Algorithms and Methods for Multi-Petaflops Simulations}}, note = {proposal to DOE SciDAC3}, month = mar, year = {2012} } @Article{ elemental2012, author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and Robert {v}an~{d}e~{G}eijn}, title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, journal = {{ACM} Transactions on Mathematical Software}, volume = {39}, number = {2}, year = {2013} } @Misc{ elemental-web-page, author = {Jack Poulson}, title = {Elemental: Distributed memory dense linear algebra}, howpublished = {\url{http://libelemental.org}}, url = {http://libelemental.org/}, year = {2015} } @Book{ scalesreport, title = {A Science-based Case for Large-scale Simulation}, editor = {D. E. Keyes}, publisher = {U.S. Department of Energy}, year = {2004}, url = {http://www.pnl.gov/scales} } @InProceedings{ cilk95, address = {Santa Barbara, California}, author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. Leiserson and Keith H. Randall and Yuli Zhou}, booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of Parallel Programming (PPoPP)}, day = {19--21}, month = jul, pages = {207--216}, title = {{Cilk}: An Efficient Multithreaded Runtime System}, year = {1995} } @Misc{ valgrind-web-page, author = {Julian Seward}, title = {Valgrind}, url = {http://valgrind.org/}, howpublished = {\url{http://valgrind.org/}}, year = {2012} } @Article{ blas79, author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, title = {Basic linear algebra subprograms for Fortran usage}, journal = {ACM Transactions on Mathematical Software}, volume = {5}, pages = {308--323}, year = {1979} } @TechReport{ lapack90, author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, title = {{LAPACK}: A portable linear algebra library for high-performance computers}, institution = {Computer Science Dept., University of Tennessee}, number = {CS-90-105}, month = may, year = {1990} } @TechReport{ nvidiafermi, author = {NVIDIA}, title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, institution = {NVIDIA}, year = {2009} } @Misc{ intelmic, author = {Many Core Group, Cambridge University}, title = {Intel Many Integrated Core Architecture}, howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, month = dec, year = {2010} } @Article{ abusufahkucklawrie81, author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, title = {On the Performance Enhancement of Paging Systems Through Program Analysis and Transformations}, journal = {IEEE Trans. Comput.}, volume = {30}, number = {5}, pages = {341--356}, year = {1981} } @InProceedings{ guobikshandifraguelagarzaranpadua08, author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. and Padua, David}, title = {Programming with tiles}, booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of parallel programming}, series = {PPoPP '08}, year = {2008}, isbn = {978-1-59593-795-7}, location = {Salt Lake City, UT}, pages = {111--122}, numpages = {12}, doi = {10.1145/1345206.1345225}, acmid = {1345225}, publisher = {ACM}, address = {New York, NY} } @Article{ strout04, journal = {International Journal of High Performance Computing Applications}, year = {2004}, title = {Sparse Tiling for Stationary Iterative Methods}, month = feb, publisher = {Sage Publications}, pages = {95-114}, volume = {18}, number = {1}, author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} } @Misc{ openclstandard, author = {Khronos Group}, title = {{OpenCL} 1.2 Specification}, howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, year = {2011} } @Misc{ stlguide, author = {SGI}, title = {Standard Template Library Programmer's Guide}, howpublished = {\url{http://www.sgi.com/tech/stl/}}, url = {http://www.sgi.com/tech/stl/}, year = {2011} } @Book{ stepanov09, author = {Alexander Stepanov and Paul McJones}, title = {Elements of Programming}, publisher = {Addison-Wesley}, isbn = {978-0-321-63537-2}, year = {2009} } @Article{ bangerthhartmannkanschat2007, author = {W. Bangerth and R. Hartmann and G. Kanschat}, title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, journal = {ACM Trans. Math. Softw.}, year = {2007}, volume = {33}, number = {4}, pages = {24/1--24/27} } @Misc{ dealii-web-page, author = {W. Bangerth and R. Hartmann and G. Kanschat}, title = {{deal.II}}, howpublished = {\url{http://www.dealii.org/}}, url = {http://www.dealii.org/}, year = {2012} } @InBook{ siek2012, title = {The C++0x ``Concepts'' Effort}, author = {Jeremy G. Siek}, editor = {Jeremy Gibbons}, booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, UK, March 22-26, 2010, Revised Lectures}, pages = {175--216}, isbn = {978-3-642-32202-0}, doi = {10.1007/978-3-642-32202-0_4}, url = {http://arxiv.org/abs/1201.0027}, note = {\url{http://arxiv.org/abs/1201.0027}}, publisher = {Springer Berlin Heidelberg}, year = {2012} } @Misc{ sharpclaw, note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, author = {Ketcheson, D. I. and Parsani, M.}, keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic PDEs,sharpclaw,software}, mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic PDEs,sharpclaw,software}, title = {{SharpClaw software}}, year = {2011} } @Book{ leveque2002, title = {Finite volume methods for hyperbolic problems}, author = {Randall J LeVeque}, volume = {31}, year = {2002} } @Misc{ clawpack45, note = {\url{http://www.clawpack.org}}, author = {LeVeque, R. J. and Berger, M. J.}, keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, title = {{Clawpack Software version 4.5}}, url = {www.clawpack.org}, year = {2011} } @Article{ nilsen2010, archiveprefix = {arXiv}, arxivid = {arXiv:1002.0705v1}, author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, eprint = {arXiv:1002.0705v1}, file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the parallelization of scientific codes by a function-centric approach in Python.pdf:pdf}, journal = {Computational Science \& Discovery}, keywords = {parallel,programming,python,software}, mendeley-tags = {parallel,programming,python,software}, pages = {015003}, publisher = {IOP Publishing}, title = {{Simplifying the parallelization of scientific codes by a function-centric approach in Python}}, url = {http://iopscience.iop.org/1749-4699/3/1/015003}, volume = {3}, year = {2010} } @Book{ langtangen09, author = {Hans Petter Langtangen}, title = {Python Scripting for Computational Science}, publisher = {Springer}, series = {Texts in Computational Science and Engineering}, pages = {784}, isbn = {3540739157}, year = {2009} } @Book{ numpyguide, author = {Travis E. Oliphant}, title = {Guide to {N}umpy}, publisher = {Trelgol}, year = {2008} } @Misc{ pycuda, author = {Andreas Kl\"ockner}, title = {{PyCUDA}}, howpublished = {\url{http://mathema.tician.de/software/pycuda}}, year = {2011} } @Misc{ pyopencl, author = {Andreas Kl\"ockner}, title = {{PyOpenCL}}, howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, year = {2011} } @Article{ klockner2012, author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and Paul Ivanov and Ahmed Fasih}, title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code generation}, journal = {Parallel Computing}, volume = {38}, number = {3}, pages = {157--174}, year = {2012}, issn = {0167-8191}, doi = {10.1016/j.parco.2011.09.001} } %%%%%% Matt Stuff %%%%%% @Article{ morrabozdagknepleyrassvesselinov, title = {A Tectonic Shift in Analytics and Computing Is Coming}, author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and Velimir Vesselinov}, journal = {Eos}, volume = {102}, doi = {10.1029/2021EO159258}, month = {Jun}, year = {2021} } @Misc{ knepley:icerm-workshop:2012, author = {David Keyes and Matthew Knepley and Katherine Yelick}, title = {Synchronization-reducing and Communication-reducing Algorithms and Programming Models for Large-scale Simulations}, note = {Workshop sponsored by the Institute for Computational and Experimental Research in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, \url{http://icerm.brown.edu/tw12-1-exascale}}, year = {2012} } @TechReport{ kirbyknepleyscott04, author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, title = {Optimal Evaluation of Finite Element Matrices}, type = {Technical Report}, number = {TR-2004-04}, institution = {University of Chicago}, url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, pages = {14}, month = may, year = {2004} } @TechReport{ kirbyknepleyscott10, author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, title = {Languages and Compilers for Variational Forms}, type = {Technical Report}, number = {TR-2010-09}, institution = {University of Chicago}, url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, month = oct, year = {2010} } @TechReport{ kirbyknepleyscott10b, author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, title = {Evaluation of the Action of Finite Element Operators}, type = {Technical Report}, number = {TR-2010-08}, institution = {University of Chicago}, url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, month = oct, year = {2010} } @TechReport{ bruneknepleyscott11, author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, title = {Exponential grids in high-dimensional space}, type = {Technical Report}, number = {TR-2011-07}, institution = {University of Chicago}, url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, month = dec, year = {2011} } @TechReport{ zheng11, author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai Zhang and Yaolin Shi}, title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with strongly variable viscosity based on {Matlab} and {CUDA}}, type = {Research Report}, number = {UMSI 2011/33}, institution = {University of Minnesota Supercomputing Institute}, url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, month = mar, year = {2011} } @InProceedings{ zheng2010, author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai Zhang and Yaolin Shi}, title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, booktitle = {Eos Transactions of the AGU}, organization = {American Geophysical Union}, note = {Fall Meeting Supplemental, Abstract IN41A-1350}, year = {2010} } @InCollection{ terrelkirbyknepleyscott12, author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott and Garth N. Wells}, title = {Finite elements for incompressible fluids}, editors = {A. Logg and K.A. Mardal and G. N. Wells}, booktitle = {Automated solutions of differential equations by the finite element method}, series = {Lecture Notes in Computational Science and Engineering}, volume = {84}, pages = {163--169}, publisher = {Springer-Verlag}, year = {2012} } @InCollection{ mardalhaga12, author = {Kent-Andre Mardal and Joachim Berdal Haga}, title = {Block preconditioning of systems of PDEs}, editors = {A. Logg and K.A. Mardal and G. N. Wells}, booktitle = {Automated solutions of differential equations by the finite element method}, series = {Lecture Notes in Computational Science and Engineering}, volume = {84}, pages = {643--655}, publisher = {Springer-Verlag}, year = {2012} } @InCollection{ kirbyknepleyloggscottterrel12, author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and Andy R. Terrel}, title = {Discrete optimization of finite element matrix evaluation}, editors = {A. Logg and K.A. Mardal and G. N. Wells}, booktitle = {Automated solutions of differential equations by the finite element method}, series = {Lecture Notes in Computational Science and Engineering}, volume = {84}, pages = {385--397}, publisher = {Springer-Verlag}, year = {2012} } @InCollection{ kirby12, author = {Robert C. Kirby}, title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, editors = {A. Logg and K.A. Mardal and G. N. Wells}, booktitle = {Automated solutions of differential equations by the finite element method}, series = {Lecture Notes in Computational Science and Engineering}, volume = {84}, publisher = {Springer-Verlag}, year = {2012} } @Article{ brownconveryhotesknepleypetropolous1993, author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and Labros Petropolous}, title = {Closed strings with low harmonics and kinks}, journal = {Physical Review D}, volume = {48}, number = {6}, year = {1993} } @Article{ minimax1996, title = {MiniMax: What has been learned thus far}, author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, journal = {Nuovo Cimento}, volume = {19}, number = {1}, pages = {1045--1049}, year = {1996} } @Article{ minimax1997, author = {Minimax Collaboration}, title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle Production}, journal = {Physical Review D}, volume = {55}, number = {9}, year = {1997} } @Article{ minimax2000, author = {Minimax Collaboration}, title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, journal = {Physical Review D}, volume = {61}, number = {3}, year = {2000} } @Article{ kirbyknepleyloggscott05, author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, title = {Optimizing the evaluation of finite element matrices}, journal = {SIAM Journal on Scientific Computing}, volume = {27}, number = {3}, pages = {741--758}, year = {2005} } @Article{ bardhanknepleyanitescu2008, author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models of Molecular Solvation}, journal = {Journal of Chemical Physics}, volume = {130}, number = {10}, pages = {104108}, note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics Research}, doi = {10.1063/1.3081148}, year = {2008} } %Poster at Biophysical Society Fall Meeting @Article{ bardhanknepley2017, author = {Jaydeep P. Bardhan and Matthew G. Knepley}, title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a Hydration-Shell {Poisson}-{Boltzmann} Model}, journal = {Biophysical Journal}, volume = {110}, number = {3}, note = {Fall Meeting Supplemental, Abstract DI14A-08}, doi = {10.1016/j.bpj.2015.11.1766}, year = {2017} } @Article{ tabrizirahimigoossensknepleybardhan2018, title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer Interface Condition (SLIC) Continuum Dielectric Model}, author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and Matthew G. Knepley and Jaydeep P. Bardhan}, journal = {International Journal of Quantum Chemistry}, note = {Accepted}, year = {2018} } @Article{ knepley2010, author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, title = {{Reproducible Research: addressing the need for data and code sharing in computational science}}, journal = {Computing in Science and Engineering}, volume = {12}, number = {5}, pages = {8--13}, url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&context=sagmb}, year = {2010} } @Article{ ketchesonahmadiaknepley2011, title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for Hyperbolic PDE Codes}, author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, journal = {SIAM News}, volume = {44}, number = {7}, month = sep, note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, year = {2011} } @Article{ yokotabardhanknepleybarbahamada2011, author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and Tsuyoshi Hamada}, title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and a billion unknowns}, journal = {Computer Physics Communications}, volume = {182}, number = {6}, pages = {1272--1283}, year = {2011}, issn = {0010-4655}, doi = {10.1016/j.cpc.2011.02.013}, url = {http://arxiv.org/abs/1007.4591} } @Article{ bardhanknepley2011, author = {Jaydeep P. Bardhan and Matthew G. Knepley}, title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact Results for Spherical Inclusions}, journal = {Journal of Chemical Physics}, volume = {135}, number = {12}, pages = {124107--124117}, url = {http://arxiv.org/abs/1109.0651}, note = {\url{http://arxiv.org/abs/1109.0651}}, year = {2011} } @Article{ bruneknepleyscott2013, author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and Graded Meshes}, journal = {SIAM Journal on Scientific Computing}, url = {http://arxiv.org/abs/1104.0261}, note = {\url{http://arxiv.org/abs/1104.0261}}, volume = {35}, number = {1}, pages = {A173--A191}, year = {2013} } @Article{ bardhanknepley2012a, author = {Jaydeep P. Bardhan and Matthew G. Knepley}, title = {Computational science and re-discovery: open-source implementations of ellipsoidal harmonics for problems in potential theory}, journal = {Computational Science \& Discovery}, volume = {5}, pages = {014006}, note = {\url{http://arxiv.org/abs/1204.0267}}, doi = {10.1088/1749-4699/5/1/014006}, year = {2012} } @Article{ kreienkampetal2013, author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and Jaydeep P. Bardhan and Mala L. Radhakrishnan}, title = {Analysis of fast boundary-integral approximations for modeling electrostatic contributions of molecular binding}, journal = {Molecular Based Mathematical Biology}, volume = {1}, pages = {124--150}, doi = {10.2478/mlbmb-2013-0007}, issn = {2299-3266}, month = jun, note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, year = {2013} } @Article{ bardhanknepleybrune2015, author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of Boundary-Integral Operators}, journal = {Molecular Based Mathematical Biology}, volume = {3}, number = {1}, pages = {1--22}, doi = {10.1515/mlbmb-2015-0001}, year = {2015} } @Article{ bardhanknepley14, author = {Jaydeep P. Bardhan and Matthew G. Knepley}, title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary Conditions}, journal = {Journal of Chemical Physics}, volume = {141}, number = {13}, pages = {131103}, doi = {10.1063/1.4897324}, year = {2014} } @InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular Electrostatics}, author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and Matthew G. Knepley}, booktitle = {Proceedings of PIERS}, pages = {1215--1221}, month = jul, url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, year = {2015} } @Article{ tabriziknepleybardhan2016, title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary condition at the solute-solvent interface}, author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, journal = {Molecular Physics}, volume = {114}, number = {16-17}, pages = {2558--2567}, doi = {10.1080/00268976.2016.1198503}, year = {2016} } % http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids @Article{ tabrizigoossensrahimiknepleybardhan2017, title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and Mixtures Using a Solvation-Layer Interface Condition}, author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and Matthew G. Knepley and Jaydeep P. Bardhan}, journal = {Journal of Chemical Physics}, volume = {146}, number = {9}, pages = {094103}, url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, eprint = {https://arxiv.org/abs/1611.02150}, doi = {10.1063/1.4977037}, note = {PMCID: PMC5336475}, year = {2017} } @Article{ tabrizigoossenscooperknepleybardhan2017, title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic Model to Linearized {Poisson}-{Boltzmann} Solvent}, author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and Matthew G. Knepley and Jaydeep P. Bardhan}, number = {6}, pages = {2897--2914}, journal = {Journal of Chemical Theory and Computation}, year = {2017} } @InProceedings{ mcclanahan2011, author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P K and Vuduc, Richard}, booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, year = {2011} } @Article{ ghyselsashbymeerbergenvanroose2013, author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, title = {Hiding global communication latency in the {GMRES} algorithm on massively parallel machines}, journal = {SIAM Journal on Scientific Computing}, volume = {35}, number = {1}, pages = {C48--C71}, year = {2013} } @Article{ ghyselsvanroose2014, author = {P. Ghysels and W. Vanroose}, title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient Algorithm}, journal = {Parallel Computing}, volume = {40}, number = {7}, pages = {224--238}, note = {7th Workshop on Parallel Matrix Algorithms and Applications}, doi = {10.1016/j.parco.2013.06.001}, year = {2014} } @InProceedings{ strzodkagoddeke06, author = {R. Strzodka and D. G\"oddeke}, title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers from Low Precision Components}, booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom Computing Machines}, note = {FCCM ’06}, pages = {259--270}, year = {2006}, organization = {IEEE Computer Society} } @InCollection{ jacquesnicolasvollaire12, author = {T. Jacques and L. Nicolas and C. Vollaire}, title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, booktitle = {High-Performance Computing and Networking}, series = {Lecture Notes in Computer Science}, volume = {1593}, pages = {1025--1031}, publisher = {Springer}, year = {1999} } @InProceedings{ hoeflerlumsdainerehm07, author = {T. Hoefler and A. Lumsdaine and W. Rehm}, title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations for MPI}}, booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, Networking, Storage and Analysis, SC07}, location = {Reno, NV}, publisher = {IEEE Computer Society/ACM}, source = {http://www.unixer.de/~htor/publications/}, month = nov, year = {2007} } @InProceedings{ hoeflersiebretlumsdaine10, author = {T. Hoefler and C. Siebert and A. Lumsdaine}, title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of Parallel Programming (PPoPP'10)}, month = jan, location = {Bangalore, India}, publisher = {ACM}, isbn = {978-1-60558-708-0}, source = {http://www.unixer.de/~htor/publications/}, pages = {159--168}, year = {2010} } @Article{ ruppweinbubjungelgrasser15, title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {43}, number = {2}, pages = {11}, year = {2016}, publisher = {ACM} } @Article{ bai_hu_reichel_1994, title = {A {Newton} basis {GMRES} implementation}, volume = {14}, url = {}, number = {}, journal = {IMA Journal of Numerical Analysis}, author = {Z. Bai and D. Hu and L. Reichel}, year = {1994}, pages = {563--581} } @Article{ chronopoulos_gear_1989, title = {{S-step} iterative methods for symmetric linear systems}, volume = {25}, url = {}, number = {}, journal = {Journal of Computational and Applied Mathematics}, author = {A. T. Chronopoulos and C. W. Gear}, year = {1989}, pages = {153--168} } @Article{ chronopoulos_1996, title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, author = {A. T. Chronopoulos and C. D. Swanson}, journal = {Parallel Computing}, volume = {22}, number = {5}, year = {1996}, pages = {623--641} } @Article{ chronopoulos_2010, author = {A. T. Chronopoulos and A. Kucherov}, title = {Block {S-step} {Krylov} Iterative Methods}, journal = {Numerical Linear Algebra with Applications}, volume = {17}, number = {1}, pages = {3--15}, year = {2010} } @Article{ sturler_vorst_1995, title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel distributed memory computers}, volume = {18}, url = {}, number = {}, journal = {Applied Numerical Mathematics}, author = {E. De Sturler and H. A. van der Vorst}, year = {1995}, pages = {441--459} } @Article{ joubert_carey_1992, title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part I: Theory}, volume = {44}, url = {}, number = {}, journal = {International journal of computer mathematics}, author = {W. D. Joubert and G. F. Carey}, year = {1992}, pages = {243--267} } @Article{ elman_saadsaylor_1986, title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems of linear equations}, volume = {7}, url = {}, number = {3}, journal = {SIAM Journal on Scientific and Statistical Computing}, author = {Howard Elman and Y. Saad and P. E. Saylor}, year = {1986}, pages = {840--855} } @Article{ golub95innerand, author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, title = {Inner and outer iterations for the {Chebyshev} algorithm}, journal = {SIAM J. Numer. Anal}, year = {1995}, volume = {35}, pages = {300--319} } @Article{ golub_varga_1961, title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, and second-order {Richardson} iterative methods, parts {I} and {II}}, volume = {3}, url = {}, number = {}, journal = {Numer. Math.}, author = {Gene Golub and R.S. Varga}, year = {1961}, pages = {147--168} } @Article{ el_maliki_guenette_fortin_2011, title = {An efficient hierarchical preconditioner for quadratic discretizations of finite element problems}, volume = {18}, doi = {10.1002/nla.757}, number = {5}, journal = {Numerical Linear Algebra with Applications}, author = {A. {El maliki} and R. Guenette and M. Fortin}, year = {2011}, pages = {789-803} } @Article{ adavani2008multigrid, title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} Constraints}, author = {Adavani, S.S. and Biros, G.}, journal = {SIAM Journal on Scientific Computing}, volume = {31}, number = {1}, pages = {369--397}, year = {2008}, publisher = {Society for Industrial and Applied Mathematics} } @Article{ horton1995space, title = {A space-time multigrid method for parabolic {PDE}s}, author = {Horton, G. and Vandewalle, S.}, journal = {SIAM Journal on Scientific Computing}, volume = {16}, number = {4}, pages = {848--864}, year = {1995} } @Article{ lewis2005model, title = {Model problems for the multigrid optimization of systems governed by differential equations}, author = {Lewis, R.M. and Nash, S.G.}, journal = {SIAM Journal on Scientific Computing}, volume = {26}, number = {6}, pages = {1811--1837}, year = {2005}, publisher = {Philadelphia, PA: SIAM, c1993-} } @Article{ nash2000mgopt, title = {A multigrid approach to discretized optimization problems}, author = {Nash, S.G.}, journal = {Optimization Methods and Software}, volume = {14}, number = {1-2}, pages = {99--116}, year = {2000}, publisher = {Taylor \& Francis} } @Article{ borzi2009multigrid, title = {Multigrid Methods for {PDE} Optimization}, author = {Borz{\`i}, A. and Schulz, V.}, journal = {SIAM Review}, volume = {51}, pages = {361}, year = {2009} } @Article{ borzi2005multigrid, title = {A multigrid scheme for elliptic constrained optimal control problems}, author = {Borz{\`i}, A. and Kunisch, K.}, journal = {Computational Optimization and Applications}, volume = {31}, number = {3}, pages = {309--333}, year = {2005}, publisher = {Springer} } @Article{ borzi2003multigrid, title = {Multigrid methods for parabolic distributed optimal control problems}, author = {Borz{\`i}, A.}, journal = {Journal of Computational and Applied Mathematics}, volume = {157}, number = {2}, pages = {365--382}, year = {2003}, publisher = {Elsevier} } @Article{ ito2002receding, title = {Receding horizon optimal control for infinite dimensional systems}, author = {Ito, K. and Kunisch, K.}, journal = {ESAIM: Control, Optimisation and Calculus of Variations}, volume = {8}, number = {1}, pages = {741--760}, year = {2002}, publisher = {Cambridge University Press} } @Article{ schulz1998solving, title = {Solving discretized optimization problems by partially reduced {SQP} methods}, author = {Schulz, V.H.}, journal = {Computing and Visualization in Science}, volume = {1}, number = {2}, pages = {83--96}, year = {1998}, publisher = {Springer} } @Article{ hazra2005aerodynamic, title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, journal = {Journal of Computational Physics}, volume = {204}, number = {1}, pages = {46--64}, year = {2005}, publisher = {Elsevier} } @Article{ mandel1985multilevel, title = {On multilevel iterative methods for integral equations of the second kind and related problems}, author = {Mandel, J.}, journal = {Numerische Mathematik}, volume = {46}, number = {1}, pages = {147--157}, year = {1985}, publisher = {Springer} } @Article{ king1992multilevel, title = {Multilevel algorithms for ill-posed problems}, author = {King, J.T.}, journal = {Numerische Mathematik}, volume = {61}, number = {1}, pages = {311--334}, year = {1992}, publisher = {Springer} } @Article{ kaltenbacher2001regularizing, title = {On the regularizing properties of a full multigrid method for ill-posed problems}, author = {Kaltenbacher, B.}, journal = {Inverse Problems}, volume = {17}, pages = {767}, year = {2001}, publisher = {IOP Publishing} } @Article{ kaltenbacher2002multi, title = {A multi-grid method with a priori and a posteriori level choice for the regularization of nonlinear ill-posed problems}, author = {Kaltenbacher, B. and Schicho, J.}, journal = {Numerische Mathematik}, volume = {93}, number = {1}, pages = {77--107}, year = {2002}, publisher = {Springer} } @Article{ burger2006regularizing, title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, author = {Burger, M. and Kaltenbacher, B.}, journal = {SIAM Journal on Numerical Analysis}, volume = {44}, pages = {153}, year = {2006} } @Article{ draganescu2008optimal, title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, journal = {Mathematics of Computation}, volume = {77}, number = {264}, pages = {2001--2038}, year = {2008} } @Article{ bastian1998additive, title = {Additive and multiplicative multi-grid---a comparison}, author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, journal = {Computing}, volume = {60}, number = {4}, pages = {345--364}, year = {1998}, publisher = {Springer} } @Article{ fournier2001multiplicative, title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of compressible flow computations on unstructured meshes}, author = {Fournier, L. and Lanteri, S.}, journal = {Applied Numerical Mathematics}, volume = {36}, number = {4}, pages = {401--426}, year = {2001}, publisher = {Elsevier} } @Article{ chow2006survey, title = {A survey of parallelization techniques for multigrid solvers}, author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD Simon, eds}, volume = {20}, pages = {179--201}, year = {2006} } @InBook{ brandt2001multiscale, title = {Multiscale scientific computation: {R}eview 2001}, author = {Brandt, A.}, booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, series = {Lecture Notes in Computational Science and Engineering}, year = {2001}, volume = {20}, pages = {3--96}, publisher = {Springer Verlag} } @InCollection{ brandt2003multigrid, title = {Multigrid solvers and multilevel optimization strategies}, author = {Brandt, A. and Ron, D.}, booktitle = {Multilevel Optimization and VLSICAD}, editors = {J. Cong and J.R. Shinnerl}, pages = {1--69}, publisher = {Kluwer Academic Publishers}, year = {2003} } @InBook{ brandt2009principles, title = {Principles of systematic upscaling}, author = {Brandt, A.}, booktitle = {Bridging the Scales in Science and Engineering}, editors = {J. Fish}, publisher = {Oxford University Press}, pages = {193--215}, year = {2009} } @Article{ livne2004coarsening, title = {Coarsening by compatible relaxation}, author = {Livne, O.E.}, journal = {Numerical Linear Algebra with Applications}, volume = {11}, number = {2-3}, pages = {205--227}, year = {2004}, publisher = {Wiley Online Library} } @InProceedings{ brandt1986stochastic, title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, author = {Brandt, A. and Ron, D. and Amit, D.J.}, booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid Methods, held at Cologne, October 1-4, 1985}, volume = {1228}, pages = {65--98}, year = {1986}, organization = {Springer} } @Article{ halko2011finding, author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing Approximate Matrix Decompositions}, journal = {SIAM Review}, volume = {53}, number = {2}, year = {2011}, pages = {217-288}, doi = {10.1137/090771806} } @InProceedings{ mhdy09, author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, booktitle = {Proceedings of SC09}, organization = {ACM}, title = {Minimizing communication in sparse matrix solvers}, doi = {10.1145/1654059.1654096}, year = {2009} } @InProceedings{ vanrosendale83, title = {Minimizing inner product data dependencies in conjugate gradient iteration}, booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, author = {J. van Rosendale}, year = {1983}, publisher = {IEEE Computer Society} } @PhDThesis{ vuduc95, title = {Quantitative performance modeling of scientific computations and creating locality in numerical algorithms}, author = {R. Vuduc}, journal = {Massachusetts Institute of Technology}, school = {Massachusetts Institute of Technology}, year = {1995} } @Article{ simoncini2003flexible, title = {Flexible inner-outer {Krylov} subspace methods}, author = {Simoncini, V. and Szyld, D.B.}, journal = {SIAM Journal on Numerical Analysis}, pages = {2219--2239}, year = {2003}, publisher = {JSTOR} } @Article{ parks2006recycling, title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, journal = {SIAM Journal on Scientific Computing}, volume = {28}, number = {5}, pages = {1651--1674}, year = {2006}, publisher = {Society for Industrial and Applied Mathematics} } @Article{ freund2003model, title = {Model reduction methods based on Krylov subspaces}, author = {Freund, R.W.}, journal = {Acta Numerica}, volume = {12}, number = {1}, pages = {267--319}, year = {2003}, publisher = {Cambridge Univ Press} } @InBook{ gutknecht2006block, title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: an introduction}, booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, author = {Gutknecht, M.H.}, editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, publisher = {Anamaya Publishers}, location = {New Delhi}, pages = {420-447}, year = {2006} } @Article{ moulton1998black, title = {The black box multigrid numerical homogenization algorithm}, author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, journal = {Journal of Computational Physics}, volume = {142}, number = {1}, pages = {80--108}, year = {1998}, publisher = {Elsevier} } @Article{ neuss2001homogenization, title = {Homogenization and multigrid}, author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, journal = {Computing}, volume = {66}, number = {1}, pages = {1--26}, year = {2001}, publisher = {Springer} } @Article{ bai2002krylov, title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical systems}, author = {Bai, Z.}, journal = {Applied Numerical Mathematics}, volume = {43}, number = {1}, pages = {9--44}, year = {2002}, publisher = {Elsevier} } @InProceedings{ dong2003piecewise, title = {Piecewise polynomial nonlinear model reduction}, author = {Dong, N. and Roychowdhury, J.}, booktitle = {Design Automation Conference, 2003. Proceedings}, pages = {484--489}, year = {2003}, organization = {IEEE} } @Article{ bond2009stable, title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear approximation and projection}, author = {Bond, B.N. and Daniel, L.}, journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, volume = {28}, number = {10}, pages = {1467--1480}, year = {2009}, publisher = {IEEE} } @Article{ xin2000front, title = {Front Propagation in Heterogeneous Media}, author = {Xin, J.}, journal = {SIAM Review}, volume = {42}, number = {2}, pages = {161--230}, year = {2000}, publisher = {Society for Industrial and Applied Mathematics} } @Article{ owhadi2011localized, title = {Localized Bases for Finite-Dimensional Homogenization Approximations with Nonseparated Scales and High Contrast}, author = {Owhadi, H. and Zhang, L.}, journal = {Multiscale Modeling and Simulation}, volume = {9}, pages = {1373}, year = {2011} } @Article{ berlyand2010flux, title = {Flux norm approach to finite dimensional homogenization approximations with non-separated scales and high contrast}, author = {Berlyand, L. and Owhadi, H.}, journal = {Archive for rational mechanics and analysis}, volume = {198}, number = {2}, pages = {677--721}, year = {2010}, publisher = {Springer} } @Article{ babuska2011optimal, title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with Application to Multiscale Problems}, author = {Babuska, I. and Lipton, R.}, journal = {Multiscale Modeling \& Simulation}, volume = {9}, pages = {373}, year = {2011} } @Article{ boettinger2002phase, title = {Phase-Field Simulation of Solidification}, author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, journal = {Annual review of materials research}, volume = {32}, number = {1}, pages = {163--194}, year = {2002}, publisher = {Annual Reviews} } @Article{ karma1998quantitative, title = {Quantitative phase-field modeling of dendritic growth in two and three dimensions}, author = {Karma, A. and Rappel, W.J.}, journal = {Physical Review E}, volume = {57}, number = {4}, pages = {4323}, year = {1998}, publisher = {APS} } @Article{ chen2002phase, title = {Phase-field models for microstructure evolution}, author = {Chen, L.Q.}, journal = {Annual review of materials research}, volume = {32}, number = {1}, pages = {113--140}, year = {2002}, publisher = {Annual Reviews} } @Article{ galbally2010reductionuq, title = {Non-linear model reduction for uncertainty quantification in large-scale inverse problems}, author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, journal = {International journal for numerical methods in engineering}, volume = {81}, number = {12}, pages = {1581--1608}, year = {2010}, publisher = {Wiley Online Library} } @Article{ griebel1995abstract, title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, author = {Griebel, M. and Oswald, P.}, journal = {Numerische Mathematik}, volume = {70}, number = {2}, pages = {163--180}, year = {1995}, publisher = {Springer} } @InProceedings{ voutchkov2006multiobjective, title = {Multiobjective optimization using surrogates}, author = {Voutchkov, I. and Keane, A.J.}, booktitle = {Adaptive Computing in Design and Manufacture}, pages = {167--175}, year = {2006}, publisher = {The MC Escher Company} } @Article{ leary2001constraint, title = {A constraint mapping approach to the structural optimization of an expensive model using surrogates}, author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, journal = {Optimization and Engineering}, volume = {2}, number = {4}, pages = {385--398}, year = {2001}, publisher = {Springer} } @InProceedings{ legresley2000airfoil, title = {Airfoil design optimization using reduced order models based on proper orthogonal decomposition}, author = {LeGresley, P.A. and Alonso, J.J.}, booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, year = {2000} } @Book{ myers2009response, title = {Response surface methodology: process and product optimization using designed experiments}, author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, volume = {705}, year = {2009}, publisher = {John Wiley \& Sons} } @Article{ carlberg2012gnat, title = {The {GNAT} method for nonlinear model reduction: effective implementation and application to computational fluid dynamics and turbulent flows}, author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, journal = {arXiv}, volume = {1207.1349}, year = {2012} } @Article{ biros2008multilevel, title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, author = {Biros, G. and Dogan, G.}, journal = {Inverse Problems}, volume = {24}, pages = {034010}, year = {2008}, publisher = {IOP Publishing} } @Article{ rees2010optimal, title = {Optimal Solvers for {PDE}-Constrained Optimization}, author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, journal = {SIAM Journal on Scientific Computing}, volume = {32}, pages = {271}, year = {2010} } @Article{ rees2010block, title = {Block-triangular preconditioners for {PDE}-constrained optimization}, author = {Rees, T. and Stoll, M.}, journal = {Numerical Linear Algebra with Applications}, volume = {17}, number = {6}, pages = {977--996}, year = {2010}, publisher = {Wiley Online Library} } @Article{ rees2011preconditioning, title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes Equations}, author = {Rees, T. and Wathen, A.J.}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {5}, pages = {2903--2926}, year = {2011}, publisher = {Society for Industrial and Applied Mathematics} } @Article{ vogel2007fbicg, title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, author = {Vogel,J.A.}, journal = {Applied Mathematics and Computation}, volume = {188}, number = {1}, pages = {226–-233}, year = {2007}, publisher = {Elsevier} } @Unpublished{ leehammond2010, author = {B. Lee and G.E. Hammond}, title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} Equation}, key = {multigrid}, note = {manuscript, 2010} } @Article{ vandeneshop2004inexact, title = {Inexact {Krylov} Subspace Methods for Linear Systems}, author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {26}, number = {1}, pages = {125--153}, year = {2004} } @Article{ fbicg.fbcgs, title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, author = {Judith A. Vogel}, journal = {Applied Mathematics and Computation}, volume = {188}, number = {1}, pages = {226--233}, year = {2007} } @Article{ simoncini2003inexact, title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific Computing}, author = {Valeria Simoncini and Daniel B. Szyld}, journal = {SIAM Journal on Scientific Computing}, volume = {25}, number = {2}, pages = {454--477}, year = {2003} } @Article{ fqmr, title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, author = {Daniel B. Szyld and Judith A. Vogel}, journal = {SIAM Journal on Scientific Computing}, volume = {23}, number = {2}, pages = {363--380}, year = {2001} } @Article{ ipcg, title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, author = {Gene H. Golub and Qiang Ye}, journal = {SIAM Journal on Scientific Computing}, volume = {21}, number = {4}, pages = {1305--1320}, year = {1999} } @Article{ idr.sonneveld, title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric Systems of Linear Equations}, author = {Peter Sonneveld and Martin B. van Gijzen}, journal = {SIAM Journal on Scientific Computing}, volume = {31}, number = {2}, pages = {1035--1062}, year = {2008} } @Article{ flexiblecg, title = {Flexible Conjugate Gradients}, author = {Yvan Notay}, journal = {SIAM Journal on Scientific Computing}, volume = {22}, number = {4}, pages = {1444--1460}, year = {2000} } @Article{ generalizedcg, title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and Variable-Step Preconditioning}, author = {O. Axelsson and P. S. Vassilevski}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {12}, number = {4}, pages = {625--644}, year = {1991} } @Article{ bicg, title = {{Conjugate Gradient} methods for indefinite systems}, author = {R. Fletcher}, journal = {Lecture Notes in Mathematics}, volume = {506}, pages = {73--89}, year = {1976} } @Article{ idr.bcgs, title = {{Bi-CGSTAB} as an induced dimension reduction method}, author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, journal = {Applied Numerical Mathematics}, volume = {60}, pages = {1100--1114}, year = {2010} } @Article{ idr.bcgsl, title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, journal = {SIAM J. Sci. Comput.}, volume = {32}, number = {5}, pages = {2687--2709}, year = {2010} } @Article{ idr.min.sync, title = {Minimizing synchronization in {IDR(s)}}, author = {T.P. Collignon and M.B. van Gijzen}, journal = {Numerical Linear Algebra with Applications}, volume = {18}, number = {5}, pages = {805--825}, year = {2011} } @TechReport{ flexible.idr, title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large Sparse Linear Systems}, author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, institution = {Delft University of Technology}, number = {11-06}, year = {2011} } @Article{ vangenuchten1980, title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated Soils}, author = {M. Th. van Genuchten}, journal = {Soil Science Society of America Journal}, volume = {44}, pages = {892--898}, year = {1980} } @Article{ gmresr94, title = {{GMRESR}: a family of nested {GMRES} methods}, author = {H. A. Van der Vorst and C. Vuik}, journal = {Numerical Linear Algebra with Applications}, volume = {1}, number = {4}, pages = {369--386}, year = {1994} } @Article{ knepley10, author = {Matthew G. Knepley}, title = {Removing the Barrier to Scalability in Parallel FMM}, journal = {CoRR}, volume = {abs/1008.2410}, note = {\url{http://arxiv.org/abs/1008.2410}}, year = {2010} } @Article{ teng1998, author = {Shang-Hua Teng}, title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive N-Body Simulation}, journal = {SIAM J. Sci. Comput.}, volume = {19}, number = {2}, month = mar, pages = {635--656}, year = {1998}, issn = {1064-8275}, numpages = {22}, doi = {10.1137/S1064827595288942}, acmid = {289842}, issue_date = {March 1998}, publisher = {Society for Industrial and Applied Mathematics}, address = {Philadelphia, PA}, keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, parallel processing, partitioning, scientific computing, the fast multipole method, tree-codes} } @InProceedings{ skinnerkramer05, author = {David Skinner and William Kramer}, title = {Understanding the causes of performance variability in HPC workloads}, booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE International}, organization = {IEEE}, pages = {137--149}, year = {2005} } @Article{ notay_2000, author = {Yvan Notay}, title = {Flexible {Conjugate Gradients}}, journal = {SIAM Journal on Scientific Computing}, volume = {22}, number = {4}, year = {2000}, pages = {1444--1460} } @Article{ bereux1996, title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow computations}, author = {Fran{\c{c}}ois B{\'e}reux}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {133}, number = {1-2}, pages = {93--124}, year = {1996} } @Article{ pawlowski2006globalization, title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the fully coupled solution of the {N}avier-{S}tokes equations}, author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, journal = {SIAM Review}, volume = {48}, number = {4}, pages = {700--721}, year = {2006}, publisher = {SIAM} } @Article{ roppshadid2009, title = {Stability of operator splitting methods for systems with indefinite operators: Advection--diffusion--reaction systems}, author = {David L Ropp and John N Shadid}, journal = {Journal of Computational Physics}, volume = {228}, number = {9}, pages = {3508--3516}, year = {2009} } @Article{ brown1985experiments, title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, journal = {SIAM Journal on Scientific and Statistical Computing}, volume = {6}, number = {2}, pages = {297--313}, year = {1985}, publisher = {SIAM} } @Article{ bicgsl_1993, author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex Spectrum}, journal = {Electronic Transactions on Numerical Analysis}, volume = {1}, year = {1993}, pages = {11--32} } @Book{ brandt2011revised, title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised Edition}, author = {Achi Brandt and Oren Livne}, year = {2011}, publisher = {SIAM} } @Article{ axelsson1990algebraic, title = {Algebraic multilevel preconditioning methods, {II}}, author = {Axelsson, O. and Vassilevski, P.S.}, journal = {SIAM Journal on Numerical Analysis}, volume = {27}, number = {6}, pages = {1569--1590}, year = {1990}, publisher = {SIAM} } @Article{ zulehner2002analysis, title = {Analysis of iterative methods for saddle point problems: a unified approach}, author = {Zulehner, W.}, journal = {Mathematics of computation}, volume = {71}, number = {238}, pages = {479--506}, year = {2002} } @Article{ pralet2010, author = {L. Giraud and A. Haidar and S. Pralet}, title = {Using multiple levels of parallelism to enhance the performance of domain decomposition solvers}, journal = {Parallel Computing}, volume = {36}, number = {5-6}, pages = {285--296}, year = {2010} } @Book{ brennerscottfem, title = {The Mathematical Theory of Finite Element Methods}, author = {Susanne C. Brenner and L. Ridgway Scott}, edition = {3rd Edition}, series = {Texts in Applied Mathematics}, year = {2008}, publisher = {Springer-Verlag} } @Book{ ortega1987iterative, title = {Iterative solution of nonlinear equations in several variables}, author = {Ortega, James M and Rheinboldt, Werner C}, volume = {30}, publisher = {Society for Industrial and Applied Mathematics}, year = {1987} } @InBook{ rheinboldtch6, author = {Werner C. Rheinboldt}, title = {6. Combinations of Processes}, booktitle = {Methods for Solving Systems of Nonlinear Equations}, chapter = {6}, pages = {59--74}, doi = {10.1137/1.9781611970012.ch6}, year = {1998} } @Article{ allgowerbohmerpotrarheinboldt86, author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, journal = {SIAM Journal on Numerical Analysis}, volume = {23}, number = {1}, pages = {160-169}, year = {1986}, doi = {10.1137/0723011} } @Article{ rheinboldt76, author = {Werner C. Rheinboldt}, title = {On measures of ill-conditioning for nonlinear equations}, journal = {Mathematics of Computation}, volume = {30}, number = {133}, pages = {104--111}, year = {1976} } @Article{ little61, author = {John D. C. Little}, title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, journal = {Operations Research}, volume = {9}, number = {3}, pages = {383--387}, note = {\url{http://www.jstor.org/stable/167570}}, year = {1961} } @Misc{ top500, author = {{TOP500 Supercomputer Sites}}, url = {http://www.top500.org}, year = {2013} } @Misc{ hassediagram, author = {Wikipedia}, title = {Hasse Diagram}, url = {http://en.wikipedia.org/wiki/Hasse_diagram}, note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, year = {2015} } @Misc{ groupoid, author = {Wikipedia}, title = {Groupoid}, url = {https://en.wikipedia.org/wiki/Groupoid}, note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, year = {2015} } @Misc{ cwcomplex, author = {Wikipedia}, title = {{CW} complex}, url = {http://en.wikipedia.org/wiki/CW_complex}, note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, year = {2015} } @Misc{ linearalgebra, author = {Wikipedia}, title = {Linear Algebra}, url = {https://en.wikipedia.org/wiki/Linear_algebra}, note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, year = {2015} } @Misc{ amdahlslaw, author = {Wikipedia}, title = {Amdahl's Law}, url = {https://en.wikipedia.org/wiki/Amdahl's_law}, note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, year = {2015} } @Misc{ gustafsonslaw, author = {Wikipedia}, title = {Gustafson's Law}, url = {https://en.wikipedia.org/wiki/Gustafson's_law}, note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, year = {2015} } @Misc{ occamsrazor, author = {Wikipedia}, title = {Occam's razor}, url = {https://en.wikipedia.org/wiki/Occam%27s_razor}, note = {\url{https://en.wikipedia.org/wiki/Occam%27s_razor}}, year = {2015} } @InProceedings{ amdahl1967, title = {Validity of the Single Processor Approach to Achieving Large Scale Computing Capabilities}, author = {Gene M. Amdahl}, booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, series = {AFIPS '67 (Spring)}, location = {Atlantic City, New Jersey}, pages = {483--485}, numpages = {3}, doi = {10.1145/1465482.1465560}, acmid = {1465560}, publisher = {ACM}, address = {New York, NY, USA}, year = {1967} } @Article{ gustafson1988, title = {Reevaluating {Amdahl}'s Law}, author = {Gustafson, John L.}, journal = {Communications of the ACM}, volume = {31}, number = {5}, month = may, issn = {0001-0782}, pages = {532--533}, doi = {10.1145/42411.42415}, acmid = {42415}, year = {1988} } @Book{ eijkhout2014, title = {Introduction to High Performance Scientific Computing}, author = {Victor Eijkhout}, url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, publisher = {TACC}, year = {2014} } @Article{ korelc2002multilanguage, title = {Multi-language and multi-environment generation of nonlinear finite element codes}, author = {Korelc, J.}, journal = {Engineering with Computers}, volume = {18}, number = {4}, pages = {312--327}, year = {2002}, publisher = {Springer} } @TechReport{ taylor2011feap, title = {{FEAP}: A Finite Element Analysis Program}, subtitle = {Version 8.3 User Manual}, author = {R. L. Taylor}, year = {2011}, institution = {University of California, Berkeley} } @Article{ bergeraftosmismurman2005, title = {Analysis of slope limiters on irregular grids}, author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, journal = {AIAA paper}, volume = {490}, pages = {2005}, year = {2005} } @InProceedings{ ferreirabridgesbrightwell08, author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level Noise Injection}, booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, series = {SC '08}, year = {2008}, isbn = {978-1-4244-2835-9}, location = {Austin, Texas}, pages = {19:1--19:12}, articleno = {19}, numpages = {12}, url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, acmid = {1413390}, publisher = {IEEE Press}, address = {Piscataway, NJ} } @Article{ banach22, author = {Stefan Banach}, title = {Sur les op\'erations dans les ensembles abstraits et leur application aux \'equations int\'egrales}, journal = {Fund. Math.}, volume = {3}, pages = {133--181}, year = {1922} } @Article{ bangerthbursteddeheisterkronbichler2012, author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite Element Codes}, journal = {ACM Trans. Math. Softw.}, issue_date = {December 2011}, volume = {38}, number = {2}, month = jan, year = {2012}, issn = {0098-3500}, pages = {14:1--14:28}, articleno = {14}, numpages = {28}, doi = {10.1145/2049673.2049678}, acmid = {2049678}, publisher = {ACM}, address = {New York, NY, USA}, keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software design} } @Article{ eisenstatwalker1994, author = {Stanley Eisenstat and Homer Walker}, title = {Globally Convergent Inexact {N}ewton Methods}, journal = {SIAM Journal on Optimization}, volume = {4}, number = {2}, pages = {393--422}, year = {1994}, doi = {10.1137/0804022} } @Book{ blumcuckershubsmale98, title = {Complexity and Real Computation}, author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, year = {1998}, publisher = {Springer} } @Article{ caili2011, author = {Cai, X.-C. and Li, X.}, title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear Elimination for Problems with High Local Nonlinearity}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {2}, pages = {746-762}, year = {2011}, doi = {10.1137/080736272} } @Article{ cai2009, author = {X.-C. Cai}, title = { Nonlinear overlapping domain decomposition methods}, journal = {Lecture Notes in Computational Science}, volume = {70}, pages = {217-224}, year = {2009} } @Article{ lanzkronrosewilkes1996, title = {An analysis of approximate nonlinear elimination}, author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, journal = {SIAM Journal on Scientific Computing}, volume = {17}, number = {2}, pages = {538--559}, year = {1996}, publisher = {SIAM} } @TechReport{ gropp1993sowing, title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, author = {Gropp, W}, year = {1995}, number = {ANL/MCS-TM-208}, institution = {Argonne National Laboratory} } @TechReport{ gropp1993sowing2, title = {Users Manual for doctext: Producing Documentation from Source Code}, author = {Gropp, W}, year = {1995}, number = {ANL/MCS-TM-206}, institution = {Argonne National Laboratory} } @TechReport{ gropp1993simplified, title = {Simplified Linear Equation Solvers users manual}, author = {Gropp, W and Smith, B}, year = {1993}, number = {ANL--93/8}, institution = {Argonne National Laboratory} } @Misc{ simplifiedbsd, author = {{University of California, Berkeley}}, title = {Simplified {Berkeley} Software Distribution License}, note = {see \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} } @Book{ chaconstraub14, author = {Scott Chacon and Ben Straub}, title = {Pro Git}, publisher = {Apress}, year = {2014}, pages = {456}, note = {Available online at \url{http://git-scm.com/book/}} } @Misc{ bitbucket, author = {Atlassian}, title = {Bitbucket}, note = {Platform available from \url{http://bitbucket.org}} } @Misc{ gitworkflows, author = {GitWorkflows}, note = {Available at \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} } @Misc{ figshare, author = {FigShare}, note = {Available at \url{http://palgrave.figshare.com/}} } @InProceedings{ beazley1996swig, title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and {C++}}, author = {Beazley, David M}, booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, pages = {129--139}, year = {1996} } @Misc{ softwareproductivityworkshopreport14, author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, title = {Software Productivity for Extreme-Scale Science}, note = {Report on DOE Workshop, January 13-14, 2014}, url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, year = {2014} } @Misc{ softwareproductivitywhitepaper13, author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. Tang}, title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full Capability of Extreme-Scale Computing}, note = {whitepaper submitted to DOE, available via \url{http://www.orau.gov/swproductivity2014/reference.htm}}, year = {2013} } @Misc{ ideas:project, author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, howpublished = {\url{http://ideas-productivity.org}}, year = {2015} } @TechReport{ keyesmcinneswoodwardetal2012, author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep and B. Sheehan}, title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, institution = {Argonne National Laboratory}, number = {ANL/MCS-TM-330}, month = oct, year = {2012} } @Misc{ sawsfs-web-page, author = {Surtai Han and Barry Smith and Hong Zhang}, title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, year = {2015} } @Misc{ sawshk-web-page, author = {Surtai Han and Barry Smith and Hong Zhang}, title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, year = {2015} } @Misc{ sawsnestk-web-page, author = {Surtai Han and Barry Smith and Hong Zhang}, title = {{{SAWs Tutorial: Nested Krylov Method}}}, note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, year = {2015} } @Misc{ m2acs:project, author = {M. {Anitescu et al.}}, title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, howpublished = {\url{http://www.mcs.anl.gov/MACS}}, year = {2015} } @Misc{ hssmn13, author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in Developing Mathematical Libraries and Simulation Codes}, note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, year = {2013} } @Misc{ atpesc:website, key = {{Argonne Training Program for Extreme-Scale Computing}}, title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, howpublished = {\url{http://extremecomputingtraining.anl.gov}}, year = {2018} } @Article{ barraultmadaynguyenpatera2004, author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, title = {An empirical interpolation method: application to efficient reduced-basis discretization of partial differential equations}, journal = {Comptes Rendus Mathematique}, volume = {339}, number = {9}, pages = {667--672}, year = {2004}, issn = {1631-073X}, doi = {10.1016/j.crma.2004.08.006} } @Article{ simongogotsi08, title = {Materials for electrochemical capacitors}, author = {Patrice Simon and Yury Gogotsi}, journal = {Nature Materials}, volume = {7}, number = {11}, pages = {845--854}, year = {2008}, doi = {10.1038/nmat2297} } @Article{ vladsinghrollandmelinteajayangohy14, title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. Gohy}, journal = {Scientific Reports}, volume = {4}, year = {2014}, doi = {10.1038/srep04315} } @Article{ lichengshashurinkeidar12, title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, journal = {Graphene}, volume = {1}, number = {1}, pages = {1--13}, year = {2012}, doi = {10.4236/graphene.2012.11001} } @Article{ miller07, title = {A Brief History of Supercapacitors}, author = {John R. Miller}, journal = {Battery and Energy Storage Technology}, pages = {61--78}, year = {2007} } @Book{ deshpande14, title = {Ultracapacitors: Future of Energy Storage}, author = {R. P. Deshpande}, publisher = {McGraw Hill Education}, isbn = {978-9339214050}, pages = {452}, year = {2014} } @Article{ hojowboggs10, title = {Historical introduction to capacitor technology}, author = {J. Ho and T.R. Jow and S. Boggs}, journal = {IEEE Electrical Insulation Magazine}, month = jan, volume = {26}, number = {1}, pages = {20--25}, year = {2010}, doi = {10.1109/MEI.2010.5383924}, issn = {0883-7554} } @Article{ gillespie14, title = {A review of steric interactions of ions: Why some theories succeed and others fail to acount for ion size}, author = {Dirk Gillespie}, journal = {Microfluidics and Nanofluidics}, volume = {18}, number = {5-6}, pages = {717--738}, year = {2015} } @Article{ gillespievaliskoboda05, author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, title = {Density functional theory of the electrical double layer: the RFD functional}, journal = {J. Phys.: Condens. Matter}, volume = {17}, pages = {6609--6626}, year = {2005} } @Article{ valiskobodagillespie07, author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, title = {Selective adsorption of ions with different diameter and valence at highly-charged interfaces}, journal = {J. Phys. Chem. C}, volume = {111}, pages = {15575--15585}, year = {2007} } @Article{ gillespie08, author = {Dirk Gillespie}, title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor case study}, journal = {Biophys. J.}, volume = {94}, pages = {1169--1184}, year = {2008} } @Article{ liwuwang15, title = {Osmotic Pressure and Packaging Structure of Caged DNA}, author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, journal = {Biophysical Journal}, volume = {94}, number = {3}, pages = {737--746}, doi = {10.1529/biophysj.107.112508}, url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, year = {2015} } @Article{ gillespie12, title = {High energy conversion efficiency in nanofluidic channels}, author = {Dirk Gillespie}, journal = {Nano Letters}, volume = {12}, pages = {1410--1416}, year = {2012} } @Article{ dieterich79, title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, author = {James H. Dieterich}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {84}, number = {B5}, pages = {2161--2168}, year = {1979}, publisher = {Wiley Online Library} } @Article{ bodakovacsgillespiekristof14, title = {Selective transport through a model calcium channel studied by Local Equilibrium Monte Carlo simulations coupled to the Nernst--Planck equation}, author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s Krist{\'o}f}, journal = {Journal of Molecular Liquids}, volume = {189}, pages = {100--112}, year = {2014}, publisher = {Elsevier} } @Article{ brandt05, title = {Multiscale solvers and systematic upscaling in computational physics}, author = {Brandt, A}, journal = {Computer Physics Communications}, volume = {169}, number = {1}, pages = {438--441}, year = {2005}, publisher = {Elsevier} } @Article{ rosenfeld89, title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and density-functional theory of freezing}, author = {Yaakov Rosenfeld}, journal = {Physical review letters}, volume = {63}, number = {9}, pages = {980}, year = {1989}, publisher = {APS} } @Article{ schindlermitchellmccabecummingslevan13, title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT Approach}, author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and M Douglas LeVan}, journal = {The Journal of Physical Chemistry C}, volume = {117}, number = {41}, pages = {21337--21350}, year = {2013}, publisher = {ACS Publications} } @Misc{ tramonto, author = {Laura Frink and et. al.}, title = {TRAMONTO 3.0 web site}, url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, year = {2014} } @InCollection{ zhongyuenmoresiknepley15, author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, title = {Numerical Methods for Mantle Convection}, booktitle = {Treatise on Geophysics}, publisher = {Elsevier}, volume = {7}, editor = {Gerald Schubert}, edition = {second}, year = {2015} } @Article{ richarson1911, author = {Lewis Fry Richardson}, title = {The approximate arithmetical solution by finite differences of physical problems including differential equations, with an application to the stresses in a masonry dam}, journal = {Philosophical Transactions of the Royal Society A}, volume = {210}, number = {459--470}, pages = {307--357}, doi = {10.1098/rsta.1911.0009}, year = {1911} } @Article{ kirkwood34, author = {John G. Kirkwood}, title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special Application to Zwitterions}, journal = {The Journal of Chemical Physics}, volume = {2}, number = {7}, year = {1934} } @TechReport{ schoof1994exodus, title = {{EXODUS II}: a finite element data model}, author = {Larry A Schoof and Victor R Yarberry}, institution = {Sandia National Laboratories}, number = {SAND92-2137}, address = {Albuquerque, NM}, year = {1994} } @Misc{ poirier1998cgns, author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith and Fancis Y Enomoto}, title = {The CGNS system}, note = {AIAA Paper 98-3007}, year = {1998} } @Article{ deyobarashephard2001, title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, journal = {Computer-Aided Design}, volume = {33}, number = {3}, pages = {199--209}, year = {2001}, } @InProceedings{ gomezhaimesgalbraith2022, title = {On Analysis Driven Shape Design Using B-Splines}, author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, booktitle = {AIAA SciTech 2022 Forum}, pages = {1736}, year = {2022} } @InProceedings{ cloughoberaizakrajsek2019, title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, booktitle = {AIAA Aviation 2019 Forum}, pages = {3369}, year = {2019} } @InProceedings{ joegandhidannenhofferdalir2019, title = {Rapid generation of parametric aircraft structural models}, author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, booktitle = {AIAA SciTech 2019 Forum}, pages = {2229}, year = {2019} } @InProceedings{ haimesdannenhoffer2013, title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, author = {Robert Haimes and John Dannenhoffer}, booktitle = {21st AIAA Computational Fluid Dynamics Conference}, pages = {3073}, year = {2013} } @Article{ geuzaine2009gmsh, title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing facilities}, author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, journal = {International Journal for Numerical Methods in Engineering}, volume = {79}, number = {11}, pages = {1309--1331}, year = {2009}, publisher = {Wiley Online Library} } @Article{ si2015, title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, author = {Hang Si}, journal = {ACM Trans. on Mathematical Software}, volume = {41}, number = {2}, month = feb, doi = {10.1145/2629697}, year = {2015} } @TechReport{ blackerbohnhoffedwards1994, title = {CUBIT mesh generation environment. Volume 1: Users manual}, author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, institution = {Sandia National Labs., Albuquerque, NM (United States)}, year = {1994} } @Article{ bjorck1994, title = {Numerics of Gram-Schmidt orthogonalization}, author = {{\AA}ke Bj{\"o}rck}, journal = {Linear Algebra and Its Applications}, volume = {197}, pages = {297--316}, year = {1994}, publisher = {Elsevier} } @PhDThesis{ yood05, author = {Charles Nelson Yood}, title = {Argonne National Laboratory and the Emergence of Computer and Computational Science, 1946--1992}, school = {The Pennsylvania State University}, month = aug, year = {2005} } @Article{ fearnleysander79, title = {Hermann Grassmann and the Creation of Linear Algebra}, author = {Desmond Fearnley-Sander}, journal = {The American Mathematical Monthly}, volume = {86}, pages = {809--817}, url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, year = {1979} } @InCollection{ knepley2012, author = {Matthew G. Knepley}, title = {Programming Languages for Scientific Computing}, booktitle = {Encyclopedia of Applied and Computational Mathematics}, publisher = {Springer}, year = {2012}, editor = {Bj\"orn Engquist}, doi = {10.1007/978-3-540-70529-1}, url = {http://arxiv.org/abs/1209.1711} } @InBook{ knepley2015, title = {Programming Languages for Scientific Computing}, author = {Matthew G. Knepley}, booktitle = {Encyclopedia of Applied and Computational Mathematics}, editor = {Bj{\"o}rn Engquist}, publisher = {Springer Berlin Heidelberg}, address = {Berlin, Heidelberg}, pages = {1173--1181}, isbn = {978-3-540-70529-1}, doi = {10.1007/978-3-540-70529-1_250}, year = {2015} } @Book{ hughes2000, author = {Thomas J. R. Hughes}, title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, series = {Dover Civil and Mechanical Engineering}, pages = {704}, year = {2000}, isbn = {978-0486411811}, publisher = {Dover} } @Article{ roache2002, title = {Code verification by the method of manufactured solutions}, author = {Patrick J. Roache}, journal = {Journal of Fluids Engineering}, volume = {124}, number = {1}, pages = {4--10}, year = {2002}, publisher = {American Society of Mechanical Engineers} } @InCollection{ rokosgorman13, title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, author = {Georgios Rokos and Gerard Gorman}, booktitle = {Facing the Multicore-Challenge III}, series = {Lecture Notes in Computer Science}, editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, publisher = {Springer Berlin Heidelberg}, volume = {7686}, pages = {143-144}, doi = {10.1007/978-3-642-35893-7_22}, isbn = {978-3-642-35892-0}, year = {2013} } @Misc{ hdf5:homepage, author = {{The HDF Group}}, title = {The {HDF5} Homepage}, howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, year = {2015} } @Misc{ paraview:homepage, author = {Kitware}, title = {The {ParaView} Homepage}, howpublished = {\url{http://www.paraview.org/}}, year = {2015} } @Misc{ xdmf:homepage, author = {Kitware}, title = {The Extensible Data Model and Format ({XDMF})}, howpublished = {\url{http://www.xdmf.org/}}, year = {2015} } @Article{ cullerkarp1993, title = {LogP: Towards a realistic model of parallel computation}, author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, journal = {SIGPLAN Notices}, volume = {28}, number = {7}, pages = {1--12}, year = {1993}, publisher = {ACM} } @Article{ aggarwalvitter1988, title = {The input/output complexity of sorting and related problems}, author = {Alok Aggarwal and Jeffrey Vitter}, journal = {Communications of the ACM}, volume = {31}, number = {9}, pages = {1116--1127}, year = {1988}, publisher = {ACM} } @InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna Chandramowlishwaran and Richard Vuduc}, title = {Balance principles for algorithm-architecture co-design}, booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, month = may, address = {Berkeley, CA, USA}, url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, year = {2011} } @Article{ williamswatermanpatterson2009, title = {Roofline: an insightful visual performance model for multicore architectures}, author = {Samuel Williams and Andrew Waterman and David Patterson}, journal = {Communications of the ACM}, volume = {52}, number = {4}, pages = {65--76}, year = {2009}, publisher = {ACM} } @Misc{ roofline-web-page, author = {Samuel Williams and {et. al.}}, title = {{R}oofline {P}erformance {M}odel}, key = {Roofline}, url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} } @Misc{ roofline-talk2008, author = {Samuel Williams and David Patterson}, title = {{R}oofline {P}erformance {M}odel}, key = {Roofline}, year = {2008}, note = {ParLab Summer Retreat}, url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} } @Article{ lee2006, title = {The problem with threads}, author = {Edward A Lee}, journal = {Computer}, volume = {39}, number = {5}, pages = {33--42}, year = {2006}, url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, publisher = {IEEE Computer Society Press} } @Article{ hoefler2012, title = {{Optimization principles for collective neighborhood communications}}, author = {Torsten Hoefler and Timo Schneider}, journal = {International Conference for High Performance Computing, Networking, Storage and Analysis, SC}, doi = {10.1109/SC.2012.86}, isbn = {9781467308069}, issn = {21674329}, year = {2012} } @Book{ grahamknuthpatashnik1989, title = {Concrete Mathematics}, author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, publisher = {Addison-Wesley}, year = {1989} } @Book{ jackson1962, title = {Classical Electrodynamics}, author = {John David Jackson}, publisher = {John Wiley \& Sons}, year = {1962} } @Article{ leveque2013, title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, author = {Randall J. LeVeque}, journal = {SIAM News}, volume = {46}, number = {3}, month = apr, url = {http://faculty.washington.edu/rjl/pubs/topten/}, year = {2013} } @InProceedings{ wang2014, title = {Fjos: Practical, predictable, and efficient system support for fork/join parallelism}, author = {Qi Wang and Gabriel Parmer}, booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 20th}, pages = {25--36}, year = {2014}, organization = {IEEE} } @Article{ fangsaad2009, author = {Haw-ren Fang and Yousef Saad}, title = {Two classes of multisecant methods for nonlinear acceleration}, journal = {Numerical Linear Algebra with Applications}, volume = {16}, number = {3}, pages = {197--221}, year = {2009}, doi = {10.1002/nla.617} } @Misc{ hpcchallenge, title = {HPC Challenge}, author = {Jack Dongarra and Piotr Luszczek and others}, url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, year = {2015} } @InProceedings{ hoeflerschneiderlumsdaine2008, title = {Accurately measuring collective operations at massive scale}, author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed Processing (IPDPS)}, pages = {1--8}, year = {2008}, doi = {10.1109/IPDPS.2008.4536494}, organization = {IEEE} } @Book{ potraptak1984, title = {Nondiscrete Induction and Iterative Processes}, author = {Florian A. Potra and Vlastimil Pt{\'a}k}, series = {Research Notes in Mathematics}, year = {1984}, publisher = {Pitman} } @Book{ pilz1977, title = {Near-rings: the theory and its applications}, author = {G{\"u}nter Pilz}, year = {1977}, publisher = {New York} } @Article{ birkenjameson2009, title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, author = {Philipp Birken and Antony Jameson}, journal = {International Journal for Numerical Methods in Fluids}, volume = {62}, number = {5}, pages = {565--573}, publisher = {John Wiley \& Sons, Ltd.}, doi = {10.1002/fld.2030}, issn = {1097-0363}, year = {2010} } @Article{ anderson1965, title = {Iterative procedures for nonlinear integral equations}, author = {Donald G Anderson}, journal = {Journal of the ACM (JACM)}, volume = {12}, number = {4}, pages = {547--560}, year = {1965}, publisher = {ACM} } @Article{ ptak1966, title = {Some metric aspects of the open mapping and closed graph theorems}, author = {Vlastimil Pt{\'a}k}, journal = {Mathematische Annalen}, volume = {163}, number = {2}, pages = {95--104}, year = {1966}, publisher = {Springer} } @Article{ ptak1974, title = {A quantitative refinement of the closed graph theorem}, author = {Vlastimil Pt{\'a}k}, journal = {Czechoslovak Mathematical Journal}, volume = {24}, number = {3}, pages = {503--506}, year = {1974}, publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} } @Article{ ptak1975, title = {The rate of convergence of {Newton's} process}, author = {Vlastimil Pt{\'a}k}, journal = {Numerische Mathematik}, volume = {25}, number = {3}, pages = {279--285}, year = {1975}, publisher = {Springer} } @Article{ ptak1976, title = {Nondiscrete mathematical induction and iterative existence proofs}, author = {Vlastimil Pt{\'a}k}, journal = {Linear algebra and its applications}, volume = {13}, number = {3}, pages = {223--238}, year = {1976}, publisher = {Elsevier} } @Article{ ptak1977, title = {What should be a rate of convergence?}, author = {Vlastimil Pt{\'a}k}, journal = {RAIRO-Analyse num{\'e}rique}, volume = {11}, number = {3}, pages = {279--286}, year = {1977} } @Article{ potraptak1980, title = {Sharp error bounds for {Newton's} process}, author = {Florian A Potra and Vlastimil Pt{\'a}k}, journal = {Numerische Mathematik}, volume = {34}, number = {1}, pages = {63--72}, year = {1980}, publisher = {Springer} } @Article{ liesen2014, title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, author = {J{\"o}rg Liesen}, journal = {IMA Journal of Numerical Analysis}, doi = {10.1093/imanum/drv037}, archiveprefix = {arXiv}, eprint = {1405.2683}, primaryclass = {math-na}, year = {2015} } @Book{ traub1964, title = {Iterative Methods for the Solution of Equations}, author = {Joseph F Traub}, year = {1964}, publisher = {Prentice-Hall, Englewood Cliffs, NJ} } @InProceedings{ shalfvecpar2010, title = {Exascale Computing Technology Challenges}, author = {John Shalf and Sudip Dosanjh and John Morrison}, booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, pages = {1–-25}, year = {2010} } @Article{ frechet1907, title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, author = {Maurice Ren\'e Fr\'echet}, journal = {C. R. Acad. Sci. Paris}, volume = {144}, pages = {1414--1416}, year = {1907} } @Article{ riesz1907, title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, author = {Frigyes Riesz}, journal = {C. R. Acad. Sci. Paris}, volume = {144}, pages = {1409--1411}, year = {1907} } @Article{ riesz1909, title = {Sur les op\'erations fonctionnelles lin\'eaires}, author = {Frigyes Riesz}, journal = {C. R. Acad. Sci. Paris}, volume = {149}, pages = {974--977}, year = {1909} } @Misc{ rieszmarkovkakutanirepresentationtheorem, author = {Wikipedia}, title = {Riesz-Markov-Kakutani Representation Theorem}, url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, year = {2015} } @Article{ markov1938, title = {On mean values and exterior densities}, author = {Andrey Markov}, journal = {Rec. Math. Moscou}, volume = {4}, pages = {165--190}, year = {1938} } @Article{ kakutani1941, title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the space of continuous functions.)}, author = {Shizuo Kakutani}, journal = {Ann. of Math.}, volume = {2}, number = {42}, pages = {994--1024}, doi = {10.2307/1968778}, year = {1941} } @Article{ michoskimeyersonisaacwaelbroeck2014, title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of tokamaks}, author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, journal = {Journal of Computational Physics}, volume = {274}, pages = {898--919}, year = {2014}, publisher = {Elsevier} } @InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, title = {Extreme-scale AMR}, author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg Stadler and Tim Warburton and Lucas Wilcox}, booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {1--12}, year = {2010}, organization = {IEEE Computer Society}, doi = {10.1109/SC.2010.25} } @InProceedings{ isaacbursteddeghattas2012, title = {Low-cost parallel algorithms for 2: 1 octree balance}, author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th International}, pages = {426--437}, year = {2012}, organization = {IEEE}, doi = {10.1109/IPDPS.2012.47} } @Article{ isaacpetrastadlerghattas2015, title = {Scalable and efficient algorithms for the propagation of uncertainty from data through inference to prediction for large-scale problems, with application to flow of the {Antarctic} ice sheet}, author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, journal = {Journal of Computational Physics}, volume = {296}, pages = {348--368}, year = {2015}, publisher = {Elsevier}, doi = {10.1016/j.jcp.2015.04.047} } @Article{ isaacbursteddewilcoxghattas2015, title = {Recursive Algorithms for Distributed Forests of Octrees}, author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, journal = {SIAM Journal on Scientific Computing}, volume = {37}, number = {5}, pages = {C497-C531}, eprint = {1406.0089}, eprinttype = {arXiv}, year = {2015}, doi = {10.1137/140970963} } @Article{ isaacstadlerghattas2015, title = {Solution of nonlinear {S}tokes equations discretized by high-order finite elements on nonconforming and anisotropic meshes, with application to ice sheet dynamics}, author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, journal = {SIAM Journal on Scientific Computing}, number = {6}, pages = {804--833}, volume = {37}, year = {2015}, doi = {10.1137/140974407} } @InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in earth's mantle}, author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and Alessandro Curioni and Omar Ghattas}, booktitle = {Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {5}, year = {2015}, organization = {ACM}, doi = {10.1145/2807591.2807675} } @Article{ bunchhopcroft1974, title = {Triangular factorization and inversion by fast matrix multiplication}, author = {James R Bunch and John E Hopcroft}, journal = {Mathematics of Computation}, volume = {28}, number = {125}, pages = {231--236}, doi = {10.2307/2005828}, year = {1974} } @Article{ nemirovsky1991, title = {On optimality of Krylov's information when solving linear operator equations}, author = {A.S Nemirovsky}, journal = {Journal of Complexity}, volume = {7}, number = {2}, pages = {121--130}, doi = {10.1016/0885-064X(91)90001-E}, year = {1991} } @Misc{siamcseprize, author = {{PETSc Team}}, title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, url = {https://www.siam.org/prizes/sponsored/cse.php}, year = {2015} } @Article{ rathgeber2017, title = {Firedrake: automating the finite element method by composing abstractions}, author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, Graham R and Kelly, Paul HJ}, archiveprefix = {arXiv}, journal = {ACM Transaction on Mathematical Software}, eprint = {1501.01809}, volume = {43}, issue = {3}, number = {24}, year = {2017}, url = {http://arxiv.org/abs/1501.01809} } @Article{ kirby2006b, title = {Topological optimization of the evaluation of finite element matrices}, author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, journal = {SIAM Journal on Scientific Computing}, volume = {28}, number = {1}, pages = {224--240}, year = {2006}, publisher = {SIAM} } @Article{ luporini2015, author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local Assembly}, journal = {ACM Trans. Archit. Code Optim.}, issue_date = {January 2015}, volume = {11}, number = {4}, month = jan, year = {2015}, issn = {1544-3566}, pages = {57:1--57:25}, articleno = {57}, numpages = {25}, doi = {10.1145/2687415}, acmid = {2687415}, publisher = {ACM}, address = {New York, NY, USA}, keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, optimizations} } @Article{ markall2012, title = {Finite element assembly strategies on multi- and many-core architectures}, author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, C. D. and Sherwin, S. J.}, journal = {International Journal for Numerical Methods in Fluids}, year = {2013}, volume = {71}, pages = {80--97}, doi = {10.1002/fld.3648} } @Article{ markall2010, title = {Towards generating optimised finite element solvers for GPUs from high-level specifications}, author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, journal = {Procedia Computer Science}, volume = {1}, number = {1}, pages = {1815--1823}, year = {2010}, note = {{ICCS} 2010}, doi = {10.1016/j.procs.2010.04.203} } @Article{ longkirbywaanders2010, title = {Unified embedded parallel finite element computations via software-based Fr{\'e}chet differentiation}, author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, journal = {SIAM Journal on Scientific Computing}, volume = {32}, number = {6}, pages = {3323--3351}, year = {2010}, publisher = {SIAM} } @Article{ kirby2010, title = {From functional analysis to iterative methods}, author = {Robert C Kirby}, journal = {SIAM review}, volume = {52}, number = {2}, pages = {269--293}, year = {2010}, publisher = {SIAM} } @Article{ kirby2014, title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, author = {Robert C Kirby}, journal = {SIAM Journal on Scientific Computing}, volume = {36}, number = {2}, pages = {A846--A868}, year = {2014}, publisher = {SIAM} } @Article{ kirby2011, title = {Fast simplicial finite element algorithms using Bernstein polynomials}, author = {Robert C Kirby}, journal = {Numerische Mathematik}, volume = {117}, number = {4}, pages = {631--652}, year = {2011}, publisher = {Springer} } @Article{ arnoldfalkwinther2006, title = {Finite element exterior calculus, homological techniques, and applications}, author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, journal = {Acta numerica}, volume = {15}, pages = {1--155}, year = {2006}, publisher = {Cambridge Univ Press} } @Article{ arnoldlogg2014, title = {Periodic table of the finite elements}, author = {Douglas Arnold and Anders Logg}, month = nov, journal = {SIAM News}, year = {2014} } @Article{ janssonhoffmanjansson2012, title = {Framework for massively parallel adaptive finite element computational fluid dynamics on tetrahedral meshes}, author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, journal = {SIAM Journal on Scientific Computing}, volume = {34}, number = {1}, pages = {C24--C41}, year = {2012}, publisher = {SIAM} } @Article{ rogneshamcottermcrae2013, title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, journal = {Geoscientific Model Development}, volume = {6}, number = {6}, pages = {2099--2119}, year = {2013}, publisher = {Copernicus GmbH} } @Book{ loggmardalwells2012, title = {Automated solution of differential equations by the finite element method: The {FEniCS} book}, author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, volume = {84}, year = {2012}, publisher = {Springer Science \& Business Media} } @Article{ cotterkirby2014, title = {Mixed finite elements for global tide models}, author = {Colin J Cotter and Robert C Kirby}, archiveprefix = {arXiv}, journal = {Submitted}, eprint = {1410.0045}, year = {2014}, url = {http://arxiv.org/abs/1410.0045} } @Article{ kirbykieu2015, title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, author = {Robert C Kirby and Thinh Tri Kieu}, journal = {Numerische Mathematik}, volume = {130}, number = {2}, pages = {257--291}, year = {2015}, publisher = {Springer} } @Article{ brennankirby2015, title = {Finite element approximation and preconditioners for a coupled thermo-acoustic model}, author = {Brian Brennan and Robert C Kirby}, journal = {Submitted to Computers and Mathematics with Applications}, year = {2015} } @Article{ howlekirbydillon2013, title = {Block preconditioners for coupled physics problems}, author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, journal = {SIAM Journal on Scientific Computing}, volume = {35}, number = {5}, pages = {S368--S385}, year = {2013}, publisher = {SIAM} } @Book{ malekstrakos2014, title = {Preconditioning and the conjugate gradient method in the context of solving PDEs}, author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, volume = {1}, year = {2014}, publisher = {SIAM} } @Misc{ isaac2022, title = {Unifying the geometric decompositions of full and trimmed polynomial spaces in finite element exterior calculus}, author = {Toby Isaac}, eprint = {2112.02174}, archivePrefix = {arXiv}, primaryClass = {math.NA}, url = {https://arxiv.org/abs/2112.02174}, year = {2022} } @Article{ desturler1995, title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel distributed memory computers}, author = {E. de Sturler and H.A. van der Vorst}, journal = {Applied Numerical Mathematics}, volume = {18}, number = {4}, pages = {441--459}, year = {1995}, doi = {10.1016/0168-9274(95)00079-A} } @Article{ velicmaymoresi2009, title = {A fast robust algorithm for computing discrete voronoi diagrams}, author = {Velic, Mirko and May, Dave and Moresi, Louis}, journal = {Journal of Mathematical Modelling and Algorithms}, volume = {8}, number = {3}, pages = {343--355}, year = {2009}, publisher = {Springer} } @Article{ may2012, title = {Volume reconstruction of point cloud data sets derived from computational geodynamic simulations}, author = {May, DA}, journal = {Geochemistry, Geophysics, Geosystems}, volume = {13}, number = {5}, year = {2012}, publisher = {Wiley Online Library} } @Article{ quenettehodkinson2010, title = {StgDomain--scalable parallel domain software components for particle-in-cell finite element methods}, author = {Quenette, Steve and Hodkinson, Luke}, journal = {Concurrency and Computation: Practice and Experience}, volume = {22}, number = {12}, pages = {1593--1603}, year = {2010}, publisher = {Wiley Online Library} } @Book{ velic2005, title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, author = {Velic, Mirko}, year = {2005}, publisher = {Monash University} } @Article{ velicknepleymay2016, title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, note = {in preparation}, year = {2016} } @Article{ traubwozniakowski1979, title = {Convergence and complexity of Newton iteration for operator equations}, author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, journal = {Journal of the ACM (JACM)}, volume = {26}, number = {2}, pages = {250--258}, year = {1979}, publisher = {ACM} } @Article{ sterck2013, title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, author = {Hans De Sterck}, journal = {Numerical Linear Algebra with Applications}, volume = {20}, number = {3}, pages = {453--471}, year = {2013} } @Article{ sterckwinlaw2015, title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical tensor approximation}, author = {Hans De Sterck and Manda Winlaw}, journal = {Numerical Linear Algebra with Applications}, volume = {22}, number = {3}, pages = {410--432}, year = {2015} } @Article{ sterckhowse2015, title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing approximate {Tucker} tensor decompositions}, author = {Hans De Sterck and Alexander Howse}, journal = {SIAM Journal on Scientific Computing}, note = {submitted}, year = {2015} } @Book{ ladevezesimmonds1999, title = {Nonlinear computational structural mechanics: {N}ew approaches and non-incremental methods of calculation}, author = {P. Ladev{\`e}ze and J.G. Simmonds}, series = {{M}echanical {E}ngineering {S}eries}, url = {http://books.google.com/books?id=McZRAAAAMAAJ}, isbn = {9780387985947}, lccn = {98029990}, year = {1999}, publisher = {Springer} } @InProceedings{ walkerwoodwardyang2010, title = {An accelerated fixed-point iteration for solution of variably saturated flow}, author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, year = {2010} } @Article{ lottwalkerwoodwardyang2012, title = {An accelerated {P}icard method for nonlinear systems related to variably saturated flow}, author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, journal = {Advances in Water Resources}, volume = {38}, number = {0}, pages = {92--101}, doi = {10.1016/j.advwatres.2011.12.013}, year = {2012} } @TechReport{ mohrrude1998, title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, author = {Marcus Mohr and Ulrich R\"ude}, type = {Technical Report}, number = {394}, institution = {University of Augsburg}, year = {1998} } @InProceedings{ mohr2000, title = {Low Communication Parallel Multigrid}, author = {Mohr, Marcus}, booktitle = {Euro-Par 2000 Parallel Processing}, pages = {806--814}, year = {2000}, organization = {Springer} } @Article{ brandtdiskin1994, title = {Multigrid solvers on decomposed domains}, author = {Achi Brandt and Boris Diskin}, journal = {Contemporary Mathematics}, volume = {157}, year = {1994}, publisher = {AMERICAN MATHEMATICAL SOCIETY} } @InProceedings{ prabhuetal2011, title = {A Survey of the Practice of Computational Science}, author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, David I.}, booktitle = {State of the Practice Reports}, series = {SC '11}, year = {2011}, isbn = {978-1-4503-1139-7}, location = {Seattle, Washington}, pages = {19:1--19:12}, articleno = {19}, numpages = {12}, doi = {10.1145/2063348.2063374}, acmid = {2063374}, publisher = {ACM}, address = {New York, NY, USA} } @PhDThesis{ dinarthesis1979, title = {Fast methods for the numerical solution of boundary value problems}, author = {N. Dinar}, school = {Weizmann Institute of Science}, year = {1979} } @Article{ thomasdiskinbrandt2001, title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: high Reynolds number wakes and boundary layers}, author = {James L Thomas and Boris Diskin and Achi Brandt}, journal = {Computers \& fluids}, volume = {30}, number = {7}, pages = {853--874}, year = {2001}, publisher = {Elsevier} } @Article{ greenbaumptakstrakos1996, title = {Any nonincreasing convergence curve is possible for {GMRES}}, author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {17}, number = {3}, pages = {465--469}, year = {1996}, publisher = {SIAM} } @Article{ nangiapatankarbhalla2019, title = {A {DLM} immersed boundary method based wave-structure interaction solver for high density ratio multiphase flows}, author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, journal = {Journal of Computational Physics}, volume = {398}, pages = {108804}, year = {2019} } @Article{ bhallanangiadafnakisbraccomattiazzo2019, title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} library}, author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni Bracco and Giuliana Mattiazzo}, journal = {Applied Ocean Research}, note = {In press}, year = {2019} } @Article{ bhallagriffithpatankardonev2013, title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and Alexander Donev}, journal = {Journal of Chemical Physics}, volume = {139}, number = {21}, pages = {214112}, year = {2013} } @Article{ bhallabalegriffithpatankar2014, title = {Fully resolved immersed electrohydrodynamics for particle motion, electrolocation, and self-propulsion}, author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. Patankar}, journal = {Journal of Computational Physics}, volume = {256}, pages = {88--108}, year = {2014} } @Article{ usabiagakallemovdelmottebhallagriffithdonev2016, title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid multiblob approach}, author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla and Boyce E. Griffith and Alexander Donev}, journal = {Communications in Applied Mathematics and Computational Science}, volume = {11}, number = {2}, pages = {217--296}, year = {2016} } @Article{ koubhallagriffithpandolfinokahrilaspatankar2015, title = {A fully resolved active musculo-mechanical model for esophageal transport}, author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and P.J. Kahrilas and Neelesh A. Patankar}, journal = {Journal of Computational Physics}, volume = {298}, pages = {446--465}, year = {2015} } @Article{ balenevelnbhallamaciverpatankar2015, title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates and vertebrates}, author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh A. Patankar}, journal = {PLoS Biology}, volume = {13}, number = {4}, pages = {1--22}, year = {2015} } @Article{ balehaobhallapatankar2014, title = {Energy efficiency and allometry of movement of swimming and flying animals}, author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, journal = {Proceedings of the National Academy of Sciences}, volume = {111}, number = {21}, pages = {7517--7521}, year = {2014} } @Article{ bhallabalegriffithpatankar2013, title = {A unified mathematical framework and an adaptive numerical method for fluid--structure interaction with rigid, deforming, and elastic bodies}, author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A Patankar}, journal = {Journal of Computational Physics}, volume = {250}, pages = {446--476}, year = {2013}, publisher = {Elsevier} } @Article{ takeikatz2013, title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. Governing equations and linearized analysis}, author = {Yasuko Takei and Richard F. Katz}, journal = {Journal of Fluid Mechanics}, volume = {734}, issn = {1469-7645}, pages = {424--455}, numpages = {32}, doi = {10.1017/jfm.2013.482}, month = nov, year = {2013} } @Misc{ stewart2011, title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, author = {G. W. Stewart}, note = {Translated with commentary by G. W. Stewart}, url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, year = {2011} } @Article{ douglisnirenberg1955, title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, author = {Avron Douglis and Louis Nirenberg}, journal = {Communications on Pure and Applied Mathematics}, volume = {8}, pages = {503--538}, year = {1955} } @Article{ gorelickgalunsharonbasribrandt2006, title = {Shape Representation and Classification Using the Poisson Equation}, author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, volume = {28}, number = {12}, pages = {1991--2005}, year = {2006} } @Article{ salsbury2006, title = {Analysis of errors in {Still's} equation for macromolecular electrostatic solvation energies}, author = {Freddie R. Salsbury Jr.}, journal = {Molecular Physics}, volume = {104}, number = {08}, pages = {1299--1309}, year = {2006} } @Article{ sigalov2006, title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} approximation}, author = {G. Sigalov and A. Fenley and A. Onufriev}, journal = {Journal of Chemical Physics}, volume = {124}, number = {124902}, year = {2006} } @Article{ dennard1974, title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and Andre R LeBlanc}, journal = {IEEE Journal of Solid-State Circuits}, volume = {9}, number = {5}, pages = {256--268}, year = {1974} } @Article{ zeegeijn2015, author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, journal = {ACM Transactions on Mathematical Software}, volume = {41}, number = {3}, pages = {14:1--14:33}, month = jun, year = {2015}, issue_date = {jun}, doi = {10.1145/2764454} } @Article{ campbell1976, title = {Assessing the Impact of Planned Social Change}, author = {Donald T. Campbell}, journal = {Occasional Paper Series, The Public Affairs Center}, number = {8}, publisher = {Dartmouth College}, year = {1976} } @Article{ smaldinomcelreath2016, title = {The natural selection of bad science}, author = {Paul E. Smaldino and Richard McElreath}, journal = {Royal Society Open Science}, volume = {3}, number = {9}, url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, doi = {10.1098/rsos.160384}, year = {2016}, publisher = {The Royal Society} } @Article{ harlowwelch1965, title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with free surface}, author = {Francis H Harlow and J Eddie Welch}, journal = {Physics of fluids}, volume = {8}, number = {12}, pages = {2182--2189}, url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, year = {1965} } @Article{ diskinthomasmineck2005, title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, journal = {SIAM Journal on Scientific Computing}, volume = {27}, number = {1}, pages = {108--129}, doi = {10.1137/030601521}, issn = {1064-8275}, year = {2005} } @TechReport{ scott2012, title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and Computer Science}, author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave Yuen}, institution = {University of Chicago}, number = {2012-02}, url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, year = {2012} } @Article{ roth2010, title = {Fundamental measure theory for hard-sphere mixtures: a review}, author = {Roland Roth}, journal = {J. Phys. Cond. Mat.}, volume = {22}, pages = {063102}, year = {2010} } @Article{ wu2008, title = {Density functional theory for liquid structure and thermodynamics}, author = {J. Z. Wu}, journal = {Struct. Bond.}, doi = {10.1007/430_2008_3}, year = {2008} } @Article{ goel2008, title = {Molecular solvent model of cylindrical electric double layers: a systematic study by {Monte Carlo} simulations and density functional theory}, author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, journal = {J. Chem. Phys.}, volume = {129}, pages = {154707}, year = {2008} } @Article{ marchxiaoyubiros2015, title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, journal = {SIAM Journal on Scientific Computing (to appear)}, year = {2015} } @InProceedings{ yangduraiswamigumerovdavis2003, title = {Improved fast gauss transform and efficient kernel density estimation}, author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, pages = {664--671}, year = {2003}, organization = {IEEE} } @Article{ fornberglarssonflyer2011, title = {Stable computations with Gaussian radial basis functions}, author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {2}, pages = {869--892}, year = {2011}, publisher = {SIAM} } @InProceedings{ srinivasanqiduraiswami2010, title = {GPUML: Graphical processors for speeding up kernel machines}, author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, Implementations, and Applications}, year = {2010} } @Article{ jadamecbillen2010, title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around a slab edge}, author = {Margarete A Jadamec and Magali I Billen}, journal = {Nature}, volume = {465}, number = {7296}, pages = {338--341}, year = {2010} } @Article{ jadamecbillen2012, title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional numerical models of the Alaska slab edge}, author = {Margarete A Jadamec and Magali I Billen}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {117}, number = {B2}, year = {2012} } @Article{ jadamec2015, title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, author = {Margarete A Jadamec}, journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, volume = {211}, pages = {135}, year = {2015} } @Article{ durancejadamecfalloonnicholls2012, title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from olivine-hosted melt inclusions and geochemical modelling with insights from geodynamic models}, author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, journal = {Australian Journal of Earth Sciences}, volume = {59}, number = {6}, pages = {913--931}, year = {2012} } @Article{ sharplesmoresijadamecrevote2015, title = {Styles of rifting and fault spacing in numerical models of crustal extension}, author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {120}, number = {6}, pages = {4379--4404}, year = {2015} } @Article{ hayniejadamec2017, title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D geodynamic models}, author = {Kirstie L Haynie and Margarete A Jadamec}, journal = {Tectonics}, note = {in review}, year = {2017} } @Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, title = {Inferring the thermochemical structure of the upper mantle from seismic data}, author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina Lithgow-Bertelloni and Wenbo Xu}, journal = {Geophysical Journal International}, volume = {179}, number = {2}, pages = {1169--1185}, year = {2009} } @Article{ zhong2006, title = {Constraints on thermochemical convection of the mantle from plume heat flux, plume excess temperature, and upper mantle temperature}, author = {Shijie Zhong}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {111}, number = {B4}, year = {2006} } @Article{ billenhirth2007, title = {Rheologic controls on slab dynamics}, author = {Magali I Billen and Greg Hirth}, journal = {Geochemistry, Geophysics, Geosystems}, volume = {8}, number = {8}, year = {2007} } @Article{ hirthkohlstedt2003, title = {Rheology of the upper mantle and the mantle wedge: A view from the experimentalists}, author = {Greg Hirth and David Kohlstedt}, journal = {Inside the subduction Factory}, pages = {83--105}, year = {2003} } @Article{ longsilver2008, title = {The subduction zone flow field from seismic anisotropy: A global view}, author = {Maureen D Long and Paul G Silver}, journal = {science}, volume = {319}, number = {5861}, pages = {315--318}, year = {2008} } @Article{ karatowu1993, title = {Rheology of the upper mantle: A synthesis}, author = {Shun-ichiro Karato and Patrick Wu}, journal = {Science}, volume = {260}, number = {5109}, pages = {771--778}, year = {1993} } @Article{ long2013mantle, title = {Mantle flow in subduction systems: The mantle wedge flow field and implications for wedge processes}, author = {Long, Maureen D and Wirth, Erin A}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {118}, number = {2}, pages = {583--606}, year = {2013}, publisher = {Wiley Online Library} } @Article{ hoernle2008arc, title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and Alvarado, Guillermo and Protti, Marino and others}, journal = {Nature}, volume = {451}, number = {7182}, pages = {1094--1097}, year = {2008}, publisher = {Nature Publishing Group} } @Article{ savage1999, title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave splitting?}, author = {MK Savage}, journal = {Reviews of Geophysics}, volume = {37}, number = {1}, pages = {65--106}, year = {1999} } @InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, title = {Dynamic data-driven inversion for terascale simulations: Real-time identification of airborne contaminants}, author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and Omar Ghattas and Bart Van Bloemen Waanders}, booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, pages = {43}, year = {2005}, organization = {IEEE Computer Society} } @Article{ draganescusoane2013, title = {Multigrid solution of a distributed optimal control problem constrained by the {Stokes} equations}, author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, journal = {Applied Mathematics and Computation}, volume = {219}, number = {10}, pages = {5622--5634}, year = {2013} } @Article{ zhonggurnis1995, title = {Mantle convection with plates and mobile, faulted plate margins}, author = {Shijie Zhong and Michael Gurnis}, journal = {Science}, volume = {267}, number = {5199}, pages = {838}, year = {1995} } @Article{ studerbobinchahidmousavicandesdahan2012, title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi and Emmanuel Candes and Maxime Dahan}, journal = {Proceedings of the National Academy of Sciences}, volume = {109}, number = {26}, pages = {E1679--E1687}, year = {2012} } @Article{ borsukhigdonstowreckhow2001, title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic matter loading in estuaries and coastal zones}, author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, journal = {Ecological Modelling}, volume = {143}, number = {3}, pages = {165--181}, year = {2001} } @Article{ liebermanwillcox2012, title = {Goal-oriented inference: Approach, linear theory, and application to advection diffusion}, author = {Chad Lieberman and Karen Willcox}, journal = {SIAM Journal on Scientific Computing}, volume = {34}, number = {4}, pages = {A1880--A1904}, year = {2012} } @Article{ chaillatbiros2012, title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple frequencies and multiple sources for the scalar {Helmholtz} equation}, author = {St{\'e}phanie Chaillat and George Biros}, journal = {Journal of Computational Physics}, volume = {231}, number = {12}, pages = {4403--4421}, year = {2012} } @Article{ farhattezaurdjellouli2002, title = {On the solution of three-dimensional inverse obstacle acoustic scattering problems by a regularized {Newton} method}, author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, journal = {Inverse problems}, volume = {18}, number = {5}, pages = {1229}, year = {2002} } @Article{ orozcoghattas1992, title = {Massively parallel aerodynamic shape optimization}, author = {Orozco, Carlos E and Ghattas, ON}, journal = {Computing Systems in Engineering}, volume = {3}, number = {1-4}, pages = {311--320}, year = {1992} } @Article{ reutheralonsorimlingerjameson1999, title = {Aerodynamic shape optimization of supersonic aircraft configurations via an adjoint formulation on distributed memory parallel computers}, author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, journal = {Computers \& fluids}, volume = {28}, number = {4}, pages = {675--700}, year = {1999} } @Article{ rudistadlerghattas2016, title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly Heterogeneous Viscosity}, author = {Johan Rudi and Georg Stadler and Omar Ghattas}, journal = {ArXiv e-prints}, archiveprefix = {arXiv}, primaryclass = {math.NA}, eprint = {1607.03936}, month = jul, year = {2016} } @Article{ borzikunisch2006, title = {A globalization strategy for the multigrid solution of elliptic optimal control problems}, author = {Borzi, A and Kunisch, K}, journal = {Optimisation Methods and Software}, volume = {21}, number = {3}, pages = {445--459}, year = {2006} } @Article{ nash2000, title = {A multigrid approach to discretized optimization problems}, author = {Stephen G Nash}, journal = {Optimization Methods and Software}, volume = {14}, number = {1-2}, pages = {99--116}, year = {2000} } @Article{ jameson1983, title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid method}, author = {Antony Jameson}, journal = {Applied mathematics and computation}, volume = {13}, number = {3-4}, pages = {327--355}, year = {1983} } @Article{ billen2008, title = {Modeling the dynamics of subducting slabs}, author = {Magali I Billen}, journal = {Annu. Rev. Earth Planet. Sci.}, volume = {36}, pages = {325--356}, year = {2008} } @Article{ gerya2011, title = {Future directions in subduction modeling}, author = {Taras Gerya}, journal = {Journal of Geodynamics}, volume = {52}, number = {5}, pages = {344--378}, year = {2011} } @Article{ tackley2000, title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical theory}, author = {Paul J Tackley}, journal = {Science}, volume = {288}, number = {5473}, pages = {2002--2007}, year = {2000} } @Article{ caseydewey1984, title = {Initiation of subduction zones along transform and accreting plate boundaries, triple-junction evolution, and forearc spreading centres—implications for ophiolitic geology and obduction}, author = {JF Casey and JF Dewey}, journal = {Geological Society, London, Special Publications}, volume = {13}, number = {1}, pages = {269--290}, year = {1984} } @Article{ doughertyclayton2014, title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear in the {South Cocos} plate}, author = {Sara L Dougherty and Robert W Clayton}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {119}, number = {4}, pages = {3424--3447}, year = {2014} } @Article{ syracusemaceiraprietozhangammon2016, title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and velocity from the joint inversion of seismic and gravity data}, author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and Charles J Ammon}, journal = {Earth and Planetary Science Letters}, volume = {444}, pages = {139--149}, year = {2016} } @Article{ bowergurnisflament2015, title = {Assimilating lithosphere and slab history in 4-D Earth models}, author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, journal = {Physics of the Earth and Planetary Interiors}, volume = {238}, pages = {8--22}, year = {2015} } @Book{ ciarlet1976, title = {Numerical analysis of the finite element method}, author = {Philippe G Ciarlet}, volume = {59}, year = {1976}, publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} } @InProceedings{ liumellorcrummey2013, title = {A data-centric profiler for parallel programs}, author = {Xu Liu and John Mellor-Crummey}, booktitle = {2013 SC-International Conference for High Performance Computing, Networking, Storage and Analysis (SC)}, pages = {1--12}, year = {2013}, organization = {IEEE} } @InCollection{ ernstgander2012, title = {Why it is difficult to solve Helmholtz problems with classical iterative methods}, author = {Oliver G Ernst and Martin J Gander}, booktitle = {Numerical analysis of multiscale problems}, pages = {325--363}, url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, year = {2012} } @Article{ warburtonkarniadakis1999, title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, author = {Timothy C Warburton and George E Karniadakis}, journal = {Journal of Computational Physics}, volume = {152}, number = {2}, pages = {608--641}, year = {1999} } @Article{ salahsoulaimanihabashi2001, title = {A finite element method for magnetohydrodynamics}, author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {43}, number = {190}, pages = {5867--5892}, year = {2001} } @Article{ nesliturktezersezgin2005, title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, author = {Ali I Nesliturk and M Tezer-Sezgin}, journal = {Computer methods in applied mechanics and engineering}, volume = {194}, number = {9}, pages = {1201--1224}, year = {2005} } @Article{ strakschellart2016, title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated Upwellings: Insights from Analog Models}, author = {Vincent Strak and Wouter P Schellart}, journal = {Journal of Geophysical Research: Solid Earth}, year = {2016} } @InBook{ kirbyloggrognesterrel2012, title = {Common and unusual finite elements}, author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The {FEniCS} Book}, publisher = {Springer Berlin Heidelberg}, address = {Berlin, Heidelberg}, pages = {95--119}, isbn = {978-3-642-23099-8}, doi = {10.1007/978-3-642-23099-8_3}, year = {2012} } @InBook{ kirbymardal2012, author = {Robert C. Kirby and Kent-Andre Mardal}, title = {Constructing general reference finite elements}, editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The {FEniCS} Book}, publisher = {Springer Berlin Heidelberg}, address = {Berlin, Heidelberg}, pages = {121--132}, isbn = {978-3-642-23099-8}, doi = {10.1007/978-3-642-23099-8_4}, year = {2012} } @Book{ wriggers2008, title = {Nonlinear finite element methods}, author = {Peter Wriggers}, publisher = {Springer Science \& Business Media}, year = {2008} } @Book{ zienkiewicztaylor1977, title = {The finite element method}, author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, publisher = {McGraw-hill London}, volume = {3}, year = {1977} } @Article{ rogneskirbylogg2009, title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, author = {Marie E Rognes and Robert C Kirby and Anders Logg}, journal = {SIAM Journal on Scientific Computing}, volume = {31}, number = {6}, pages = {4130--4151}, year = {2009} } @Book{ kelley03, title = {Solving nonlinear equations with Newton's method}, author = {Carl T. Kelley}, publisher = {SIAM}, year = {2003} } @Article{ turing1937, title = {The Chemical Basis of Morphogenesis}, author = {A. M. Turing}, journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, volume = {237}, number = {641}, pages = {37--72}, doi = {10.1098/rstb.1952.0012}, issn = {0080-4622}, url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, year = {1952} } @Article{ fabienknepleymillsriviere2017, title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested multigrid method}, author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. Rivi\`ere}, journal = {SIAM Journal on Scientific Computing}, url = {https://arxiv.org/abs/1705.09907}, volume = {41}, number = {2}, pages = {C73--C96}, doi = {10.1137/17M1128903}, year = {2018} } @Article{ fabienknepleyriviere2018, title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous porous media}, author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, journal = {International Journal for Numerical Methods in Engineering}, volume = {116}, number = {3}, pages = {161--177}, doi = {10.1002/nme.5919}, year = {2018} } @Article{ fabienknepleyriviere2020, title = {A high order hybridizable discontinuous Galerkin method for incompressible miscible displacement in heterogeneous media}, author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, journal = {Results in Applied Mathematics}, url = {https://arxiv.org/abs/1809.00747}, volume = {8}, pages = {100089}, doi = {10.1016/j.rinam.2019.100089}, year = {2020} } @Article{ fabienknepleyriviere2019b, title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for second order elliptic problems}, author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, journal = {Journal of Numerical Mathematics}, volume = {28}, number = {3}, pages = {161--174}, doi = {10.1515/jnma-2019-0027}, year = {2019} } @Article{ fabien2019, title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear Elasticity}, author = {Maurice S. Fabien}, journal = {Communications in Computational Physics}, volume = {27}, number = {2}, pages = {513--545}, issn = {1991-7120}, doi = {10.4208/cicp.OA-2018-0235}, year = {2019} } @Unpublished{ awanoufabienguzmanstern2020, title = {Hybridization and postprocessing in finite element exterior calculus}, author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, eprint = {2008.00149}, note = {preprint}, primaryclass = {math.NA}, year = {2020} } @Article{ fabienguzmanneilanzytoon2022, title = {Low-order divergence-free approximations for the Stokes problem on Worsey--Farin and Powell--Sabin splits}, author = {Maurice Fabien and Johnny Guzm{\'a}n and Michael Neilan and Ahmed Zytoon}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {390}, pages = {114444}, year = {2022}, } @Article{ chaabanegiraultrivierethompson2018, title = {A stable enriched {G}alerkin element for the {S}tokes problem}, author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, journal = {Applied Numerical Mathematics}, volume = {132}, pages = {1--21}, issn = {0168-9274}, doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, year = {2018} } @Article{ thompsonriviereknepley2018, title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and Resuscitation In The Small Intestine}, author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, journal = {Mathematical Medicine and Biology}, volume = {36}, number = {4}, pages = {513--548}, doi = {10.1093/imammb/dqz00}, year = {2019} } @Article{ kevrekidisthompsongoriely2020, title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative Diseases}, author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, journal = {Physics Letters A}, volume = {384}, number = {36}, pages = {126935}, year = {2020} } @Article{ mardalrognesthompson2021, title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- {Stokes-Biot} Stability Revisited}, author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, journal = {BIT Numerical Mathematics}, pages = {1--36}, year = {2021} } @Article{ piersantileethompsonmardalrognes2021, title = {Parameter robust preconditioning by congruence for multiple-network poroelasticity}, author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and Rognes, Marie E}, journal = {SIAM Journal on Scientific Computing}, volume = {43}, number = {4}, pages = {B984--B1007}, year = {2021}, publisher = {SIAM} } @Article{ walkerknepleyaagaardwilliams2023, title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, journal = {Geophysical Journal International}, volume = {235}, number = {3}, pages = {2442--2475}, doi = {10.1093/gji/ggad370}, year = {2023} } @Article{ bhavsar2024influence, title = {Influence of initial slab dip, inter-plate coupling, and nonlinear rheology on dynamic weakening at the lithosphere-asthenosphere boundary}, author = {Vivek Bhavsar and Margarete A. Jadamec and Matthew G. Knepley}, journal = {Journal of Geophysical Research: Solid Earth}, doi = {10.1029/2023JB028423}, year = {2024}, } @InProceedings{ actorfuentesriviere2020b, title = {Identification of Kernels in a Convolutional Neural Network: Connections Between Level Set Equation and Deep Learning for Image Segmentation}, author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, booktitle = {Proceedings of the SPIE Medical Imaging Conference}, year = {2020} } @Article{ actorfuentesriviere2020, title = {Robust Regularized Networks in the Presence of Noise}, author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, journal = {Medical Image Analysis}, note = {In revision}, year = {2020} } @Book{ byerly1893, title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and ellipsoidal harmonics, with applications to problems in mathematical physics}, author = {William Elwood Byerly}, publisher = {Dover}, year = {1893} } @Book{ hobson1931, title = {The theory of spherical and ellipsoidal harmonics}, author = {Ernest William Hobson}, year = {1931}, publisher = {CUP Archive} } @Book{ dassios2012, title = {Ellipsoidal harmonics: theory and applications}, author = {George Dassios}, volume = {146}, year = {2012}, publisher = {Cambridge University Press} } @Book{ miller1977, title = {Symmetry and separation of variables}, author = {Miller, Jr, Willard}, year = {1977}, address = {Reading, MA}, publisher = {Addison-Wesley Publishing Co., Inc.} } @TechReport{ epanet-users-manual, author = {Lewis A. Rossman}, title = {{EPANET 2} Users Manual}, institution = {Water Supply and Water Resources Division, National Risk Management Research Laboratory, Cincinnati, OH 45268}, year = {2000} } @Article{ klocknerbarnettgreengardoneil2013, title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael O'Neil}, journal = {Journal of Computational Physics}, volume = {252}, pages = {332--349}, year = {2013} } @Article{ turcksinkronbichlerbangerth2016, title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, journal = {ACM Transactions on Mathematical Software)}, volume = {43}, number = {1}, pages = {2}, year = {2016} } @Article{ vitushkin1954, title = {On {Hilbert's} thirteenth problem}, author = {A. G. Vitushkin}, journal = {Dokl. Akad. Nauk SSSR}, volume = {95}, pages = {701--704}, year = {1954} } @Article{ kolmogorov1957, title = {On the representation of continuous functions of several variables as superpositions of continuous functions of one variable and addition}, author = {Andrei N. Kolmogorov}, journal = {Dokl. Akad. Nauk SSSR}, pages = {953--956}, volume = {114:5}, note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, year = {1957} } @Article{ fridman1967, title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition Theorem}}, author = {B. L. Fridman}, journal = {Dokl. Akad. Nauk SSR}, volume = {177:5}, pages = {1019--1022}, note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, year = {1967} } @Article{ sprecher1972, title = {An improvement in The {Superposition Theorem of Kolmogorov}}, author = {David Sprecher}, journal = {Journal of Mathematical Analysis and Applications}, volume = {38}, pages = {208--213}, year = {1972} } @Article{ diaconisshahshahani1984, title = {On nonlinear functions of linear combinations}, author = {Persi Diaconis and Mehrdad Shahshahani}, journal = {SIAM Journal on Scientific and Statistical Computing}, volume = {5}, number = {1}, pages = {175--191}, year = {1984}, publisher = {SIAM} } @InProceedings{ hechtnielsen1987, title = {Kolmogorov's mapping neural network existence theorem}, author = {R. Hecht-Nielsen}, booktitle = {Proceedings of the International Conference on Neural Networks}, volume = {III}, pages = {11--14}, publisher = {IEEE Press}, year = {1987} } @InProceedings{ hechtnielsen1989, title = {Theory of the back-propagation neural network}, author = {R. Hecht-Nielsen}, booktitle = {Proceedings of the International Joint Conference on Neural Networks}, volume = {I}, pages = {593--608}, publisher = {IEEE Press}, year = {1989} } @Article{ girosipoggio1989, title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, author = {Federico Girosi and Tomaso Poggio}, journal = {Neural Computation}, volume = {1}, number = {4}, pages = {465--469}, year = {1989}, publisher = {MIT Press} } @InBook{ koppen2002, title = {On the Training of a Kolmogorov Network}, author = {Mario K\"oppen}, pages = {474--9}, publisher = {ICANN 2002, LNCS 2415}, year = {2002} } @PhDThesis{ bryant2008, title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in applications with low and high dimensional data}, author = {Donald W Bryant}, school = {University of Central Florida}, year = {2008} } @InCollection{ griebel2006, title = {Sparse Grids for Higher Dimensional Problems}, author = {Michael Griebel}, booktitle = {Foundations of Computational Mathematics}, editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, publisher = {Cambridge University Press}, pages = {106--161}, doi = {10.1017/CBO9780511721571.004}, url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, month = jun, day = {29}, year = {2006} } @Article{ braungriebel2009, title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, author = {Jurgen Bra\"un and Michael Griebel}, journal = {Constructive Approximation}, pages = {653--675}, volume = {30}, year = {2009} } @InProceedings{ lenifougerolletruchetet2009, title = {Kolmogorov superposition theorem and its application to wavelet image decompositions}, author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings of the SPIE}, pages = {724804--724804}, doi = {10.1117/12.805916}, url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, year = {2009} } @Article{ oseledets2011, title = {Tensor-train decomposition}, author = {Ivan V Oseledets}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {5}, pages = {2295--2317}, year = {2011} } @PhDThesis{ liu2015, title = {Kolmogorov superposition theorem and its applications}, author = {Xing Liu}, school = {Imperial College London}, year = {2015} } @Article{ lecunbengiohinton2015, title = {Deep learning}, author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, journal = {Nature}, volume = {521}, number = {7553}, pages = {436--444}, year = {2015} } @Book{ trefethen2013, title = {Approximation theory and approximation practice}, author = {Lloyd N Trefethen}, publisher = {SIAM}, year = {2013} } @Article{ butlergrahammattiswalsh2017, title = {A measure-theoretic interpretation of sample based numerical integration with applications to inverse and prediction problems under uncertainty}, author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, journal = {SIAM Journal on Scientific Computing}, volume = {39}, number = {5}, pages = {A2072--A2098}, year = {2017} } @Article{ logg2009, title = {Efficient representation of computational meshes}, author = {Anders Logg}, journal = {International Journal of Computational Science and Engineering}, volume = {4}, number = {4}, pages = {283--295}, year = {2009} } @Article{ agelekandersonbangerthbarth2017, title = {On orienting edges of unstructured two-and three-dimensional meshes}, author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {44}, number = {1}, pages = {5}, year = {2017} } @Article{ actorknepley2018, title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's Superposition Theorem}}, author = {Jonas Actor and Matthew G. Knepley}, eprint = {1712.08286}, archiveprefix = {arXiv}, primaryclass = {math.na}, note = {\url{http://arxiv.org/abs/1712.08286}}, year = {2018} } @Book{ driscollhaletrefethen2014, title = {Chebfun guide}, author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, publisher = {Pafnuty Publications, Oxford}, year = {2014} } @Article{ johntobiska2000, title = {Numerical performance of smoothers in coupled multigrid methods for the parallel solution of the incompressible Navier-Stokes equations}, author = {Volker John and Lutz Tobiska}, journal = {International Journal for Numerical Methods in Fluids}, volume = {33}, number = {4}, pages = {453--473}, year = {2000} } @Article{ vanka1986, title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, author = {S. P. Vanka}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {59}, number = {1}, pages = {29--48}, year = {1986} } @Article{ bartelgunther2018, author = {Andreas Bartel and Michael G\"unther}, title = {{PDAEs} in refined electrical network modeling}, journal = {SIAM Review}, volume = {60}, number = {1}, pages = {56--91}, doi = {10.1137/17M1113643}, year = {2018} } @Article{ matpower, author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power systems research and education}, journal = {IEEE Transactions on Power Systems}, volume = {26}, number = {1}, pages = {12--19}, year = {2011}, doi = {10.1109/TPWRS.2010.2051168} } @Article{ betrieyan2018, author = {G. Betrie and E. Yan}, title = {Development and Verification of Thermoelectric Power Plant Model for Assessing Energy and Water Nexus}, journal = {Applied Energy, Submitted}, volume = {}, number = {}, pages = {}, doi = {}, year = {2018} } @Article{ faeth2012, author = {P. Faeth}, title = {{U.S.} Energy Security and Water: The Challenges We Face}, journal = {Environment: Science and Policy for Sustainable Development}, volume = {54(1)}, number = {1}, pages = {4--19}, year = {2012}, doi = {10.1080/00139157.2012.639595} } @InProceedings{ hagberg2008, title = {Exploring network structure, dynamics, and function using {NetworkX}}, author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, year = {2008}, pages = {11--15} } @Misc{ simulink-web-page, author = {Mathworks}, title = {{SIMULINK} web page}, note = {\url{https://www.mathworks.com/products/simulink.html}}, year = {2017} } @Misc{ labview-web-page, author = {National Instruments}, title = {{LabVIEW} web page}, note = {\url{http://www.ni.com/labview/}}, key = {labview}, year = {2017} } @Misc{ modelica-web-page, author = {Modelica Association}, title = {Modelica web page}, note = {\url{https://www.modelica.org/}}, year = {2017} } @InProceedings{ yangsc16, author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, booktitle = {{SC '16}: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric Dynamics}, note = {Gordon Bell Award}, year = {2016} } @InProceedings{ bekassc15, author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, booktitle = {{SC '15}: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in Earth's Mantle}, note = {Gordon Bell Award}, year = {2015} } @Misc{ improving-software-whitepaper2017, author = {M. Heroux and L.C. McInnes}, title = {Improving and accelerating scientific discovery through better software}, note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, doi = {10.6084/m9.figshare.5339692}, year = {2017} } @Misc{ doe:40thanniversarycollection, title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have changed the face of science}, key = {Department of Energy, Office of Science}, howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, year = {2017} } @Misc{ siam:fellowsprogram, title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, key = {SIAM}, howpublished = {\url{http://www.siam.org/prizes/fellows}} } @Misc{ r-and-d100:awards2009, title = {{R\&D100 Award Winners 2009}}, key = {{R\&D100 Award Winners 2009}}, howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} } @Misc{ xsdk:website, title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, key = {xSDK: Extreme-scale Scientific Software Development Kit}, howpublished = {\url{https://xsdk.info}} } @Misc{ xsdk-community-installation-policies2017, title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, note = {version 0.3, November 7, 2017}, doi = {10.6084/m9.figshare.4495133}, year = {2017} } @Misc{ xsdk-community-package-policies2017, title = {{xSDK} Community Package Policies}, author = {B. Smith and R. Bartlett and {xSDK developers}}, note = {version 0.3, November 7, 2017}, doi = {10.6084/m9.figshare.4495136}, year = {2017} } @Misc{ ideas-what-are-interoperable-libraries, title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and Ulrike Yang and {all xSDK developers}}, note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via \url{https://ideas-productivity.org/resources/howtos/}}, year = {2016} } @Misc{ ideas-productivity:website, title = {{IDEAS Scientific Software Productivity Project}}, key = {IDEAS Scientific Software Productivity Project}, howpublished = {\url{https://ideas-productivity.org}} } @Misc{ ecp:website, key = {{U.S. DOE Exascale Computing Project (ECP)}}, title = {{U.S. DOE Exascale Computing Project (ECP)}}, note = {\url{https://exascaleproject.org}}, year = {2018} } @Misc{ siam-cse-jan2018, author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} and George Biros and Hans Bungartz and James Corones and Evin Cramer and James Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, title = {Research and Education in Computational Science and Engineering}, note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM Review}}, year = {2018} } @Misc{ doe-appliedmathpimeeting2017, author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen Willcox and Steven Lee}, title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, year = {2017} } @Misc{ doe-fusionintegratedsimulationsworkshopreport2015, author = {P. Bonoli and L. C. {McInnes (Chairs)}}, title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy Sciences}}, note = {available via \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, year = {2015} } @Misc{ sisc-specialissueintro, title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE Software'} and {'Big Data in CSE'}}, author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, month = nov, year = {2016}, journal = {SIAM J. Sci. Comput.}, doi = {10.1137/16N974188} } @Article{ xsdk-foundations2017, title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, journal = {Supercomputing Frontiers and Innovations}, month = feb, year = {2017}, note = {available via \url{https://arxiv.org/abs/1702.08425}} } @Misc{ openfoam:website, title = {{OpenFOAM}}, author = {OpenFOAM Team}, key = {OpenFOAM}, howpublished = {\url{https://openfoam.com}} } @Misc{ mfem:website, title = {{MFEM}}, author = {Tzanio Kolev and MFEM Team}, key = {MFEM}, howpublished = {\url{https://mfem.org}} } @Misc{ deal.ii:website, title = {{{deal.II}: An open-source finite element library}}, author = {Wolfgang Bangerth and Deal.II Team}, howpublished = {\url{http://www.dealii.org}}, year = {2018} } @Misc{ ibamr:website, title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, author = {Boyce Griffith and IBAMR Team}, howpublished = {\url{https://ibamr.github.io/}}, year = {2023} } @Misc{ fission-gas-scidac:website, title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, author = {A. David {Andersson (PI)}}, howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, year = {2018} } @Misc{ tokamak-disruption-scidac:project, title = {{Tokamak Disruption Simulation}}, author = {Xianzhu {Tang (PI)}}, howpublished = {SciDAC project}, year = {2018} } @InProceedings{ duplyakin2018memory, title = {Evaluating Active Learning with Cost and Memory Awareness}, author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, pages = {214--223}, year = {2018}, organization = {IEEE}, pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} } @InProceedings{ duplyakin2016active, author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, title = {Active Learning in Performance Analysis}, booktitle = {Proceedings of the IEEE Cluster Conference}, year = {2016}, month = sep, url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} } @Misc{ xgc1:website, title = {{XGC1 project website}}, author = {C. S. Chang and others}, howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, year = {2018} } @Misc{ wdmapp-bhattacharjee-ecp:website, title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion Plasmas}}, author = {A. Bhattacharjee and others}, note = {ECP application project}, howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, year = {2018} } @Misc{ subsurface-steefel-ecp:website, title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, and Mechanics}}, note = {ECP application project}, author = {C. Steefel and others}, howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, year = {2018} } @Article{ chombo-crunch:2014, title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated with Carbon Sequestration}, author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, journal = {Computing in Science and Engineering}, volume = {16}, issue = {6}, year = {2014}, pages = {22--31}, doi = {10.1109/MCSE.2014.77} } @Article{ courantfriedrichslewy1967, title = {On the partial difference equations of mathematical physics}, author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, journal = {IBM journal of Research and Development}, volume = {11}, number = {2}, pages = {215--234}, year = {1967}, publisher = {IBM} } @Article{ erway2017solving, title = {On solving large-scale limited-memory quasi-Newton equations}, author = {Erway, Jennifer B and Marcia, Roummel F}, journal = {Linear Algebra and its Applications}, volume = {515}, pages = {196--225}, year = {2017}, publisher = {Elsevier} } @Article{ griewank2012broyden, title = {Broyden updating, the good and the bad!}, author = {Griewank, Andreas}, journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, pages = {301--315}, year = {2012} } @Book{ tarantola2005, title = {Inverse problem theory and methods for model parameter estimation}, author = {Albert Tarantola}, volume = {89}, year = {2005}, publisher = {SIAM} } @Article{ rutkaikristof2010, title = {Dynamic Monte Carlo simulation in mixtures}, author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, journal = {The Journal of Chemical Physics}, volume = {132}, number = {10}, pages = {104107}, year = {2010}, publisher = {AIP} } @Book{ vogel2002, title = {Computational methods for inverse problems}, author = {Curtis R Vogel}, volume = {23}, year = {2002}, publisher = {SIAM} } @Article{ malqvistpeterseim2014, title = {Localization of elliptic multiscale problems}, author = {Axel M{\aa}lqvist and Daniel Peterseim}, journal = {Mathematics of Computation}, volume = {83}, number = {290}, pages = {2583--2603}, year = {2014} } @Article{ brandtbrannickkahllivshits2011, title = {Bootstrap {AMG}}, author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, journal = {SIAM Journal on Scientific Computing}, volume = {33}, number = {2}, pages = {612--632}, year = {2011} } @InProceedings{ barralalauzet2014, title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change moving mesh strategy}, author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, booktitle = {44th AIAA Fluid Dynamics Conference}, pages = {2773}, year = {2014} } @InProceedings{ barralalauzetloseille2015, title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent problems involving moving geometries}, author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, booktitle = {53rd AIAA Aerospace Sciences Meeting}, pages = {2039}, year = {2015} } @Article{ barralolivieralauzet2017, title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent problems with body-fitted moving geometries}, author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, journal = {Journal of Computational Physics}, volume = {331}, pages = {157--187}, year = {2017} } @Article{ ibanezbarralkrakosloseillemichalpark2017, title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd Michal and Mike Park}, journal = {Procedia engineering}, volume = {203}, pages = {154--166}, year = {2017} } @InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and Joshua A Krakos and Todd R Michal and Adrien Loseille}, booktitle = {2018 AIAA Aerospace Sciences Meeting}, pages = {1103}, year = {2018} } @InProceedings{ barralangeloudiskramergormanpiggott2018, title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics modelling}, author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman and Matthew D Piggott}, booktitle = {EGU General Assembly Conference Abstracts}, volume = {20}, pages = {19168}, year = {2018} } @Article{ principe2009, title = {{Mathematical models for thermally coupled low speed flows}}, author = {Javier Principe and Ramon Codina}, journal = {Advances in Theoretical and Applied Mechanics}, volume = {2}, number = {1-4}, pages = {93--112}, url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, year = {2009} } @Book{ vandervorst2003, title = {Iterative {K}rylov Methods for Large Linear Systems}, author = {van der Vorst, H.}, isbn = {9780521818285}, publisher = {Cambridge University Press}, year = {2003} } @Book{ peres2006, author = {Asher Peres}, title = {Quantum theory: concepts and methods}, volume = {57}, publisher = {Springer Science \& Business Media}, year = {2006} } @Book{ kuttler2012, title = {Linear algebra: theory and applications}, author = {Kenneth Kuttler}, url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, year = {2012} } @Book{ elman_silvester_wathen_2014, place = {Oxford}, title = {Finite elements and fast iterative solvers: with applications in incompressible fluid dynamics}, publisher = {Oxford University Press}, author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, year = {2014} } @Article{ alametal2007, title = {An evaluation of the ORNL Cray XT3}, author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, journal = {International Journal of High Performance Computing Applications}, volume = {22}, number = {1}, pages = {52--80}, doi = {10.1177/1094342007085019}, year = {2007} } @Article{ plazacarey2000, title = {Local refinement of simplicial grids based on the skeleton}, author = {Plaza, A. and Carey, Graham F.}, journal = {Applied Numerical Mathematics}, doi = {10.1016/S0168-9274(99)00022-7}, issn = {01689274}, volume = {32}, number = {2}, pages = {195--218}, year = {2000} } @Article{ carsonstrakos2020, title = {On the cost of iterative computations}, author = {Eric Carson and Zden\v{e}k Strako\v{s}}, journal = {Phil. Trans. R. Soc. A}, volume = {378}, number = {20190050}, doi = {10.1098/rsta.2019.0050}, url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, year = {2020} } @Article{ schoberl1999, title = {Multigrid methods for a parameter dependent problem in primal variables}, author = {Joachim Sch{\"o}berl}, journal = {Numerische Mathematik}, volume = {84}, number = {1}, pages = {97--119}, year = {1999} } @Article{ wuleexuzikatanov2008, title = {Convergence analysis on iterative methods for semidefinite systems}, author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, journal = {Journal of Computational Mathematics}, pages = {797--815}, year = {2008} } @Article{ maierrannacher2016, title = {Duality-based adaptivity in finite element discretization of heterogeneous multiscale problems}, author = {Maier, Matthias and Rannacher, Rolf}, journal = {Journal of Numerical Mathematics}, volume = {24}, number = {3}, pages = {167--187}, year = {2016} } @Article{ maierrannacher2018, title = {A duality-based optimization approach for model adaptivity in heterogeneous multiscale problems}, author = {Maier, Matthias and Rannacher, Rolf}, journal = {Multiscale Modeling \& Simulation}, volume = {16}, number = {1}, pages = {412--428}, year = {2018} } @Article{ margetismaierluskin2017, title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite metamaterial sheet}, author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, journal = {Studies in Applied Mathematics}, volume = {139}, number = {4}, pages = {599--625}, year = {2017} } @Article{ maiermargetisluskin2017b, title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element approximation and validation}, author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, journal = {Journal of Computational Physics}, volume = {339}, pages = {126--145}, year = {2017} } @Article{ maiermargetisluskin2018, title = {Generation of surface plasmon-polaritons by edge effects}, author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, journal = {Communications in Mathematical Sciences}, volume = {16}, number = {1}, pages = {77--95}, url = {http://arxiv.org/abs/1702.00848}, year = {2018} } @Article{ maiermattheakiskaxirasluskinmargetis2018, title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic metamaterials}, author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, Mitchell and Margetis, Dionisios}, journal = {Physical Review B}, volume = {97}, number = {3}, pages = {035307}, year = {2018} } @Article{ maiermattheakiskaxirasluskinmargetis2019, title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, Mitchell and Margetis, Dionisios}, journal = {Proceedings of the Royal Society A}, volume = {475}, number = {2230}, pages = {20190220}, year = {2019} } @Article{ maiermargetisluskin2020, title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of two scales}, author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, journal = {Physical Review B}, volume = {102}, number = {7}, pages = {075308}, year = {2020} } @Article{ margetismaierstauberlowluskin2020, title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and Luskin, Mitchell}, journal = {Journal of Physics A: Mathematical and Theoretical}, volume = {53}, number = {5}, pages = {055201}, year = {2020} } @Article{ maiermargetismellet2020, title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic structures}, author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, journal = {Journal of Computational and Applied Mathematics}, volume = {377}, pages = {112909}, year = {2020} } @Article{ maierkronbichler2021, title = {Efficient parallel 3D computation of the compressible Euler equations with an invariant-domain preserving second-order finite-element scheme}, author = {Maier, Matthias and Kronbichler, Martin}, journal = {ACM Transactions on Parallel Computing}, volume = {8}, number = {3}, pages = {1--30}, year = {2021} } @Article{ guermondmaierpopovtomas2021, title = {Second-order invariant domain preserving approximation of the compressible Navier--Stokes equations}, author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {375}, pages = {113608}, year = {2021} } @Article{ liliptonmaier2021, title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, author = {Li, Wei and Lipton, Robert and Maier, Matthias}, eprint = {2009.12166}, archiveprefix = {arXiv}, primaryclass = {phys.optics}, year = {2021} } @Article{ songmaierluskin2020, title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling gradient-index graphene waveguides}, author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, journal = {Journal of Computational Physics}, volume = {423}, pages = {109871}, year = {2020} } @Article{ songmaierluskin2019, title = {Adaptive finite element simulations of waveguide configurations involving parallel 2D material sheets}, author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {351}, pages = {20--34}, year = {2019} } % %

Users Who have Visited ANL for Consulting on PETSc

% % @Unpublished{ rob1, author = {Rob Kunz}, institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania State University}, url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, sponsors = {U.S. Navy, NRC}, note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD simulations, including lake warming by power plants}, dates = {Oct 3 and 4, 2002}, email = {rfk@wt.arl.psu.edu} } @Unpublished{ au1, author = {Feng Wang and William Appelbe}, institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, url = {http://www.vpac.org}, sponsors = { }, note = {Using PETSc for a Variety of Geophysical Simulations}, dates = {Nov 22, 2002} } @Unpublished{ carl1, author = {Carl Sovinec}, institution = {Applied Physics, University of Wisconsin}, url = {http://nimrodteam.org}, sponsors = {DOE Office of Fusion Research}, note = {Investigating using PETSc for NIMROD}, dates = {Nov 21, 2002}, email = {sovinec@engr.wisc.edu} } @Unpublished{ au1b, author = {Pablo Carrica and Robert Wilson}, institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, url = {http://}, sponsors = {Office of Naval Research}, note = {Using PETSc for a hydrodynamics of ships and submarines}, dates = {Sept, 2002}, email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} } % ------------------- TAO References ---------------------- @Article{ benson:2001:csp, author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, journal = {{ACM} Transactions on Mathematical Software}, volume = {27}, number = {3}, month = sep, year = {2001}, pages = {361--376} } @TechReport{ tao-user-ref-2000, author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, title = {{TAO} Users Manual}, year = {2000}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, number = {ANL/MCS-TM-242}, note = {See \url{http://www.mcs.anl.gov/tao}} } % ------------------- Optimization References ---------------------- @Book{ optguide93, title = {Optimization Software Guide}, author = {Jorge J. Mor\'{e} and Stephen J. Wright}, publisher = {SIAM Publications}, address = {Philadelphia}, year = {1993} } @InProceedings{ more84, author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. Hillstrom}, title = {The {MINPACK} Project}, booktitle = {Sources and Development of Mathematical Software}, editor = {Wayne R. Cowell}, year = {1984}, pages = {88--111} } @Article{ steihaug:83, author = {Trond Steihaug}, title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, journal = {SIAM J. Numer. Anal.}, volume = {20}, year = {1983}, pages = {626--637}, key = {steihaug92 ! trust_region} } @TechReport{ minpack2test, author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, title = {The {MINPACK-2} Test Problem Collection}, institution = {Argonne National Laboratory}, year = {1991}, number = {ANL/MCS-TM-150}, key = {more91 ! MINPACK-2} } @TechReport{ hohmann:94, author = {Andreas Hohmann}, title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, year = {1994}, number = {SC-94-4}, key = {Hohmann94} } @TechReport{ meza:94, author = {Juan C. Meza}, title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, institution = {Sandia National Laboratory}, year = {1994}, number = {SAND94-8225}, key = {Meza94} } @Book{ dennis:83, author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, publisher = {Prentice-Hall, Inc.}, address = {Englewood Cliffs, NJ}, year = {1983} } @TechReport{ more:92, author = {Jorge J. Mor\'{e} and David Thuente}, title = {Line search algorithms with guaranteed sufficient decrease}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, year = {1992}, number = {MCS-P330-1092} } @Article{ more-toraldo, author = {Jorge J. Mor\'e and G. Toraldo}, journal = {SIOPT}, pages = {93--113}, title = {On the solution of large quadratic programming problems with bound constraints}, volume = {1}, year = {1991} } @Article{ byrd:1995:lma, author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, title = {A Limited Memory Algorithm for Bound Constrained Optimization}, journal = {SIAM Journal on Scientific Computing}, volume = {16}, number = {5}, pages = {1190--1208}, month = sep, year = {1995}, coden = {SJOCE3}, issn = {1064-8275 (print), 1095-7197 (electronic)}, mrclass = {90C30 (65K05)}, mrnumber = {96e:90039}, mrreviewer = {Henry Wolkowicz}, bibdate = {Fri Dec 4 16:17:35 MST 1998} } @Article{ lin_c3, author = {C.-J. Lin and J. J. Mor\'e}, title = {Newton's method for large bound-constrained optimization problems}, year = {1999}, journal = {SIOPT}, volume = {9(4)}, pages = {1100--1127}, url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} } @TechReport{ dolan2, author = {E. Dolan and J. J. Mor\'{e}}, title = {Benchmarking Optimization Software with Performance Profiles}, year = {2001}, month = jan, number = {ANL/MCS-P861-1200}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, address = {Argonne, IL}, url = {http://www.mcs.anl.gov/~more/cops/} } @InProceedings{ owlqn, author = {Galen Andrew and Jianfeng Gao}, title = {Scalable training of L1-regularized log-linear models}, booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, pages = {33--40}, year = {2007} } @Article{ bmrm, author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, title = {Bundle methods for regularized risk minimization}, year = {2010}, journal = {Journal of Machine Learning Research}, volume = {11}, pages = {311--365} } % ------------------- Component Software References ---------------------- @InProceedings{ cca99, author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. McInnes and S. Parker and B. Smolinski}, title = {Toward a Common Component Architecture for High-Performance Scientific Computing}, booktitle = {Proceedings of {High Performance Distributed Computing}}, pages = {115--124}, year = {1999}, note = {See \url{http://cca-forum.org}} } @Book{ szyperski98, author = {Clemens Szyperski}, title = {Component Software: Beyond Object-Oriented Programming}, publisher = {ACM Press}, address = {New York}, year = {1998} } @Article{ broy98, author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael Stal and Clemens Szyperski}, title = {What Characterizes a (Software) Component?}, journal = {Software -- Concepts and Tools}, publisher = {Springer-Verlag}, year = {1998}, volume = {19}, pages = {49--56} } @Article{ componentware:94, author = {Jon Udell}, title = {Componentware}, journal = {Byte}, volume = {may}, pages = {46--56}, year = {1994}, key = {Udell94 ! componentware} } @Misc{ cca-web-page, author = {{Common Component Architecture Forum}}, note = {See \url{http://cca-forum.org}} } % --------------- References for Tools Used by TAO Developers ----------------- % % tohtml: Used to generate on-line TAO users manual and manual pages % @TechReport{ tohtml, author = {William Gropp}, title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, institution = {Argonne National Laboratory}, number = {ANL/MCS-TM-00}, month = jan, year = {1995}, key = {tohtml} } % % doctext: Used to generate tex version of TAO manual pages % @TechReport{ doctext, author = {William Gropp}, title = {Users Manual for doctext: Producing documentation from {C} source code}, institution = {Argonne National Laboratory}, number = {ANL/MCS-TM-00}, month = jan, year = {1995}, key = {doctext} } % % bfort: Used to generate TAO Fortran interface % @TechReport{ bfort, author = {William Gropp}, title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, institution = {Argonne National Laboratory}, number = {ANL/MCS-TM-208}, month = mar, year = {1995}, key = {doctext} } % ------------------------- PETSc References ------------------------------ @InProceedings{ petsc, author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, title = {Efficient Management of Parallelism in Object Oriented Numerical Software Libraries}, booktitle = {Modern Software Tools in Scientific Computing}, editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, publisher = {Birkhauser Press}, pages = {163--202}, year = {1997} } % ------------------------- Misc Other References ------------------------------ @Misc{ indeps-web-page, title = {{InDEPS} {W}eb page}, note = {http://z.ca.sandia.gov/\~{ }indeps/}, author = {et al. Robert Armstrong}, institution = {Sandia National Laboratory}, key = {{InDEPS} {W}eb page} } @Misc{ pooma, title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar chitectures}, year = {1996}, author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} } @Misc{ isis++-web-page, title = {{ISIS++} {W}eb Page}, note = {See \url{http://ca.sandia.gov/isis}}, author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, institution = {Sandia National Laboratories} } @Misc{ trilinos-web-page, title = {{Trilinos} {W}eb Page}, note = {See \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, author = {Mike Heroux et al.}, institution = {Sandia National Laboratories} } @Misc{ alice-web-page, title = {{ALICE} {W}eb page}, note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, Argonne National Laboratory}, key = {{ALICE} {W}eb page} } @Misc{ autodiff-webpage, author = {{Computational Differentiation Project}}, note = {See \url{http://www.mcs.anl.gov/autodiff}} } @Misc{ coool-home-page, author = {Lydia Deng and Wences Gouveia and John Scales}, title = {{The CWP Object-Oriented Optimization Library}}, note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} } @Misc{ rice-inversion-home-page, author = {Mark S. Gokenbach and William W. Symes}, title = {{The Hilbert Class Library}}, note = {See \url{http://www.trip.caam.rice.edu/}} } @Misc{ opt++-home-page, author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} } @Article{ gockenbach:1999:ccl, author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, title = {C++ Classes for Linking Optimization with Complex Simulations}, journal = {{ACM} Transactions on Mathematical Software}, volume = {25}, number = {2}, month = jun, year = {1999}, pages = {191-212}, abstract = {The object-oriented programming paradigm can be used to overcome the incompatibilities between off-the-shelf optimization software and application software. The Hilbert Class Library (HCL) defines the fundamental mathematical objects arising in optimization problems, such as vectors, linear operators, and so forth, as C++ classes, making it possible to write optimization code in a natural fashion, while allowing application software such as simulators to use the most convenient data structures and programming style. In spite of the poor reputation C++ has for runtime performance, the use of mixed-language programming allows performance equal to that achieved by standard Fortran packages, as comparisons with the popular code LBFGS and ARPACK demonstrate.}, accepted = {April 1999}, url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} } @Misc{ neos-guide, author = {{The Optimization Software Guide}}, note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} } @Article{ boyd, title = {Distributed optimization and statistical learning via the alternating direction method of multipliers}, author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, Jonathan and others}, journal = {Foundations and Trends{\textregistered} in Machine learning}, volume = {3}, number = {1}, pages = {1-122}, year = {2011}, publisher = {Now Publishers, Inc.} } @Misc{ :alertsys, title = {page{ALERT}}, organization = {Alert Systems, Inc}, address = {Madison, Wisconsin}, note = {http://www.alertsys.com/} } @Manual{ :cmfortran, title = {{CM} {F}ortran Language Reference Manual}, organization = {Thinking Machines Corporation}, year = {1994}, address = {Cambridge, MA} } @Manual{ :cmmd, title = {{CMMD} Reference Manual, Version 3.0}, organization = {Thinking Machines Corporation}, year = {1993}, address = {Cambridge, MA} } @Manual{ :cmssl, title = {{CMSSL} for {CM} {F}ortran}, volume = {I}, organization = {Thinking Machines Corporation}, year = {1994}, address = {Cambridge, MA} } @Misc{ :condor, author = {M. Livny}, title = {{PI}, The {Condor} Project, High Throughput Computing}, howpublished = {www.cs.wisc.edu/condor} } @Manual{ :connection, title = {Connection Machine {CM}--5 Technical Summary}, organization = {Thinking Machines Corporation}, year = {1993}, address = {Cambridge, MA} } @Manual{ :cplex, title = {{CPLEX} Optimizer}, organization = {ILOG CPLEX Division}, address = {889 Alder Avenue, Incline Village, Nevada}, note = {http://www.cplex.com/} } @Manual{ :cplextm, title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer (Version 2.0)}, organization = {CPLEX Optimization Inc.}, year = {1992}, address = {Incline Village, Nevada} } @Misc{ :fatcop, author = {M. C. Ferris}, title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming Solver}, howpublished = {www.cs.wisc.edu/math-prog/fatcop} } @Misc{ :metaneos, author = {S. J. Wright}, title = {{metaNEOS}: Metacomputing Environments for Optimization}, howpublished = {www-unix.mcs.anl.gov/metaneos} } @InCollection{ gropp.more:optimization, author = {W. Gropp and J. J. Mor\'e}, title = {Optimization environments and the {NEOS} Server}, booktitle = {Approximation Theory and Optimization}, pages = {167--182}, publisher = {Cambridge University Press}, year = {1997}, editor = {M. D. Buhmann and A. Iserles} } @Article{ czyzyk.mesnier.ea:neos, author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, title = {The {NEOS} Server}, journal = {IEEE Journal on Computational Science and Engineering}, volume = {5}, year = {1998}, pages = {68--75} } @Book{ :osl, title = {Handbook for {IBM OSL}}, author = {M. S. Hung and W. O. Rom and A. D. Warren}, year = {1994}, publisher = {Boyd and Fraser}, address = {Danvers, Massachusetts} } @Manual{ :pro-matlab, title = {{PRO}--{MATLAB} User's Guide}, organization = {The MathWorks, Inc.}, year = {1989}, address = {21 Eliot Street, South Natick, MA 01760} } @Misc{ :prostate, key = {Biomedical}, title = {Biomedical Business International Newsletter}, howpublished = {pp. 72--75}, year = {1996} } @Misc{ :sipcase, key = {Natural}, title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} } @Book{ aarts.korst:simulated, author = {E. Aarts and J. Korst}, title = {Simulated Annealing and Boltzman Machines}, year = {1990}, publisher = {John Wiley \& Sons}, address = {Chichester} } @TechReport{ aarts.laarhoven.ea:local-search-based, author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, title = {Local-Search-Based Algorithms for Job Shop Scheduling}, institution = {Centre for Quantitative Methods}, year = {1991}, address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, number = {106}, type = {CQM-Not} } @Article{ aashtiani.magnanti:equilibria, author = {H. Z. Aashtiani and T. L. Magnanti}, title = {Equilibria on a congested transportation network}, journal = {SIAM Journal on Algebraic and Discrete Methods}, volume = {2}, year = {1981}, pages = {213--226} } @Article{ ablow.brigham:analog, author = {C. M. Ablow and G. Brigham}, title = {An Analog Solution of Programming Problems}, journal = {Operations Research}, year = {1955}, volume = {3}, pages = {388--394} } @Article{ achuthan.grabowski.ea:optimal, author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, journal = {Opsearch}, year = {1981}, volume = {18}, pages = {117--138} } @Book{ adelman.robinson:income, author = {I. Adelman and S. Robinson}, title = {Income Distribution Policy in Developing Countries}, publisher = {Stanford University Press}, year = {1978}, address = {Stanford, California} } @Article{ adler.resende.ea:implementation, author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, journal = {Mathematical Programming}, year = {1989}, volume = {44}, pages = {297--336} } @TechReport{ aeberhard.coomans.ea:comparison, author = {S. Aeberhard and D. Coomans and O. de Vel}, title = {Comparison of Classifiers in High Dimensional Settings}, institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook University of North Queensland}, year = {1992}, number = {92-02}, type = {Technical Report} } @Article{ aganagic.cottle:constructive, author = {M. Aganagi\'{c} and R. W. Cottle}, title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal Minors}, journal = {Mathematical Programming}, year = {1987}, volume = {37}, pages = {223--231} } @TechReport{ aganagic:iterative, author = {M. Aganagi\'{c}}, title = {Iterative Methods for the Linear Complementarity Problem}, institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford University}, year = {1978}, type = {SOL}, number = {78-10}, address = {Stanford, California} } @Book{ ahlfors:complex, author = {L. V. Ahlfors}, title = {Complex Analysis}, publisher = {McGraw--Hill Book Company}, address = {New York}, series = {International Series in Pure and Applied Mathematics}, edition = {Second}, year = {1966} } @Article{ ahn:solution, author = {B--H. Ahn}, title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, journal = {Journal of Optimization Theory and Applications}, year = {1981}, volume = {33}, pages = {175--185} } @Article{ al-fahed.stavroulakis.ea:hard, author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, title = {Hard and soft fingered robot grippers. The linear complementarity approach}, journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, volume = {71}, year = {1991}, pages = {257--265} } @Article{ al-fahed.stavroulakis.ea:linear, author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, title = {A linear complementarity approach to the frictionless gripper}, journal = {International Journal of Robotic Research}, volume = {11}, year = {1992}, pages = {112--122} } @Article{ al-khayyal.falk:jointly, author = {F. A. Al--Khayyal and J. E. Falk}, title = {Jointly Constrained Biconvex Programming}, journal = {Mathematics of Operations Research}, year = {1983}, volume = {8}, pages = {273--286} } @Article{ al-khayyal.kyparisis:finite, author = {F. A. Al--Khayyal and J. Kyparisis}, title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational Inequalities}, journal = {Journal of Optimization Theory and Applications}, year = {1991}, volume = {70}, pages = {319--332} } @PhDThesis{ al-khayyal:biconvex, author = {F. A. Al--Khayyal}, title = {Biconvex Programming and Biconcave Minimization}, year = {1977}, school = {The George Washington University} } @Article{ alart.curnier:mixed, author = {P. Alart and A. Curnier}, title = {A mixed formulation for frictional contact problems prone to {N}ewton like solution methods}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {92}, year = {1991}, pages = {353--375} } @Misc{ alexander.kellog.ea:piecewise, author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, title = {Piecewise smooth continuation}, howpublished = {Manuscript}, year = {1979} } @InCollection{ alexander.li.ea:piecewise, author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, title = {Piecewise smooth homotopies}, booktitle = {Homotopy Methods and Global Convergence}, pages = {1--14}, publisher = {Plenum Press}, year = {1983}, editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, address = {New York} } @InCollection{ alexander:topological, author = {J.~C. Alexander}, title = {The topological theory of an embedding method}, booktitle = {Continuation Methods}, pages = {37--68}, publisher = {Academic Press}, year = {1978}, editor = {H. Wacker}, address = {New York} } @Book{ allen:probability, author = {A. O. Allen}, title = {Probability, Statistics and Queueing Theory}, publisher = {Academic Press}, year = {1990}, address = {London}, edition = {Second} } @Book{ allgower.georg:numerical, author = {E. L. Allgower and K. Georg}, title = {Numerical Continuation Methods, An Introduction}, publisher = {Springer-Verlag}, year = {1990}, address = {Berlin} } @InProceedings{ allgower.georg:predictor-corrector, crossref = {bachem.grotschel.ea:mathematical}, author = {E. L. Allgower and K. Georg}, title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and Zero Points of Nonlinear Mappings}, pages = {15--56} } @Article{ aluffi-pentini.parisi.ea:algorithm, author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization Algorithm}, journal = {ACM Transactions on Mathematical Software}, year = {1988}, volume = {14}, pages = {366--380} } @Article{ anandalingam.friesz:hierarchical, author = {G. Anandalingam and T. L. Friesz}, title = {Hierarchical Optimization: An Introduction}, journal = {Annals of Operations Research}, year = {1992}, volume = {34}, pages = {1--11} } @Article{ anandalingam.white:solution, author = {G. Anandalingam and D. J. White}, title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty Functions}, journal = {IEEE Transactions on Automatic Control}, year = {1990}, volume = {35}, number = {10}, pages = {1170--1173} } @Article{ andersen.andersen:presolving, author = {E. Andersen and K. Andersen}, title = {Presolving in Linear Programming}, year = {1995}, journal = {Mathematical Programming}, volume = {71}, pages = {221--245} } @InProceedings{ andersen.ye:homogeneous, author = {E. Andersen and Y. Ye}, title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear Equality Constraints}, crossref = {ferris.pang:complementarity}, pages = {1--11} } @Book{ anderson.bai.ea:lapack, author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. Sorensen}, title = {{LAPACK} User's Guide}, publisher = {SIAM}, year = {1995}, address = {Philadelphia, Pennsylvania}, edition = {Second} } @Article{ anderson.ferris:direct, author = {E. J. Anderson and M. C. Ferris}, title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, year = {2001}, journal = {SIAM Journal on Optimization, forthcoming}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, key = {55} } @InProceedings{ anderson.ferris:genetic, author = {E. J. Anderson and M. C. Ferris}, title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, Waterloo, Ontario, Canada, May 28--30}, publisher = {University of Waterloo Press}, key = {14}, year = {1990} } @Article{ anderson.ferris:genetic*1, author = {E. J. Anderson and M. C. Ferris}, title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing Problem}, journal = {ORSA Journal on Computing}, year = {1994}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, volume = {6}, pages = {161--173}, key = {22} } @InProceedings{ anderson.ferris:parallel, author = {E. J. Anderson and M. C. Ferris}, title = {Parallel Genetic Algorithms in Optimization}, booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific Computing, Chicago, Illinois, December 11-13}, year = {1989}, key = {12} } @Unpublished{ anderson.lewis:primal, author = {E. J. Anderson and A. S. Lewis}, title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, note = {In preparation} } @Book{ anderson.nash:linear, author = {E. J. Anderson and P. Nash}, title = {Linear Programming in Infinite--Dimensional Spaces}, year = {1987}, publisher = {John Wiley \& Sons}, address = {Chichester} } @InProceedings{ anderson:primal, author = {E. J. Anderson}, title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear Programming, Cambridge, September 1984}, year = {1985}, editor = {E. J. Anderson and A. B. Philpott}, publisher = {Springer-Verlag}, address = {Berlin} } @Article{ andradottir:method, author = {S. Andrad\'{o}ttir}, title = {A Method of Discrete Stochastic Optimization}, journal = {Management Science}, year = {1995}, volume = {41}, pages = {1946--1961} } @Article{ andradottir:global, author = {S. Andrad\'{o}ttir}, title = {A Global Search Method for Discrete Stochastic Optimization}, journal = {SIAM Journal on Optimization}, year = {1996}, volume = {6}, pages = {513--530} } @TechReport{ anitescu.lesaja.ea:infeasible-interior-point, author = {M. Anitescu and G. Lesaja and F. A. Potra}, title = {An infeasible--interior--point predictor--corrector algorithm for the {P}$_x$--geometric {LCP}}, institution = {Department of Mathematics, The University of Iowa}, address = {Iowa City, Iowa}, year = {1994}, number = {62}, type = {Reports on Computational Mathematics} } @TechReport{ anitescu.potra:formulating, author = {M. Anitescu and F. A. Potra}, title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable Linear Complementarity Problems}, institution = {Department of Mathematics, The University of Iowa}, year = {1996}, type = {Report}, number = {93}, address = {Iowa City, Iowa} } @Article{ anstreicher.lee.ea:crashing, author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, title = {Crashing a Maximum-Weight Complementarity Basis}, journal = {Mathematical Programming}, year = {1992}, volume = {54}, pages = {281--294} } @Article{ anstreicher:combined, author = {K. M. Anstreicher}, title = {A combined phase {I}--phase {II} scaled potential algorithm for linear programming}, journal = {Mathematical Programming}, year = {1991}, volume = {52}, pages = {429--440} } @Article{ anstreicher:combined*1, author = {K. M. Anstreicher}, title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, journal = {Mathematical Programming}, year = {1989}, volume = {43}, pages = {209--223} } @InCollection{ arbenz.gander.ea:remote, author = {P. Arbenz and W. Gander and M. Oettli}, title = {The Remote Computational System}, booktitle = {High-Performance Computation and Networks}, publisher = {Springer-Verlag}, year = {1996}, volume = {1067}, series = {Lecture Notes in Computer Science}, pages = {662--667} } @InCollection{ arcus:comsoal, author = {A. L. Arcus}, title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, booktitle = {Readings in Production and Operations Management}, year = {1966}, editor = {E. S. Buffa}, publisher = {John Wiley \& Sons}, address = {New York} } @TechReport{ arioli.chan.ea:computing, author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear Optimization Calculations}, institution = {CERFACS}, year = {1993}, number = {TR/PA/93/34} } @Article{ armijo:minimization, author = {L. Armijo}, title = {Minimization of Functions having {L}ipschitz-continuous First Partial Derivatives}, journal = {Pacific Journal of Mathematics}, year = {1966}, volume = {16}, pages = {1--3} } @Article{ arrow.debreu:existence, author = {K. Arrow and G. Debreu}, title = {Existence of Equilibrium for a Competitive Economy}, journal = {Econometrica}, year = {1954}, volume = {22}, pages = {265--290} } @InCollection{ arrow.solow:gradient, author = {K. J. Arrow and R. M. Solow}, title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, booktitle = {Studies in Linear and Nonlinear Programming}, year = {1958}, editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, publisher = {Stanford University Press}, address = {Stanford, California}, pages = {166--176} } @Book{ aubin.ekeland:nonlinear, author = {J.-P. Aubin and I. Ekeland}, title = {Applied nonlinear analysis}, publisher = {John Wiley \& Sons}, address = {New York}, year = {1984} } @Article{ auchmuty:variational, author = {G. Auchmuty}, title = {Variational Principles for Variational Inequalities}, journal = {Numerical Functional Analysis and Optimization}, year = {1989}, volume = {10}, pages = {863--874} } @Book{ auerbach.kotlikoff:dynamic, author = {A. J. Auerbach and L. J. Kotlikoff}, title = {Dynamic Fiscal Policy}, publisher = {Cambridge University Press}, address = {Cambridge, England}, year = {1987} } @InProceedings{ ault.deutsch.ea:interpolating, author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, title = {Interpolating Subspaces in Approximation Theory}, booktitle = {Approximation Theory}, year = {1970}, editor = {A. Talbot}, publisher = {Academic Press}, address = {London} } @Article{ auslender.crouzeix:global, author = {A. A. Auslender and J.--P. Crouzeix}, title = {Global Regularity Theorems}, journal = {Mathematics of Operations Research}, year = {1988}, volume = {13}, pages = {243--253} } @Article{ auslender.haddou:interior-proximal, author = {A. Auslender and M. Haddou}, title = {An interior-proximal method for convex linearly constrained problems and its extension to variational inequalities}, year = {1995}, journal = {Mathematical Programming}, pages = {77--100}, volume = {71} } @Article{ auslender:convergence, author = {A. Auslender}, title = {Convergence of stationary sequences for variational inequalities with maximal monotone operators}, journal = {Applied Mathematics and Optimization}, volume = {28}, year = {1993}, pages = {161--172} } @Book{ auslender:optimization, author = {A. Auslender}, title = {Optimization {M}\'{e}thodes Num\'{e}riques}, year = {1976}, publisher = {Masson}, address = {Paris} } @TechReport{ averick.carter.ea:minpack-2, author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, title = {The {MINPACK-2} Test Problem Collection}, institution = {Argonne National Laboratory}, year = {1992}, address = {Argonne, Illinois}, number = {MCS-P153-0692} } @TechReport{ axline.billups.ea:guidelines, author = {R. A. Axline and S. C. Billups and M. F. Grady}, title = {Guidelines for Software Security ({U})}, institution = {SNL}, year = {1989}, month = oct, address = {Albuquerque, New Mexico}, number = {SAND88-2955} } @Article{ ayres.walter:greenhouse, author = {R. U. Ayres and J. Walter}, title = {The Greenhouse Effect: Damages, Costs and Abatement}, journal = {Environmental and Resource Economics}, year = {1991}, volume = {1}, pages = {237--270} } @PhDThesis{ bagley:behaviour, author = {J. D. Bagley}, title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation Algorithms}, year = {1967}, school = {University of Michigan} } @Article{ bain.stewart:application, author = {R. S. Bain and W. E. Stewart}, title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear Algebraic Equation Systems}, journal = {Computers in Chemical Engineering}, year = {1991}, volume = {15}, pages = {203--208} } @Article{ baker.lasdon:successive, author = {T. E. Baker and L. S. Lasdon}, title = {Successive Linear Programming at {E}xxon}, journal = {Management Science}, year = {1985}, volume = {31}, pages = {264--274} } @InProceedings{ baker:reducing, crossref = {grefenstette:genetic}, author = {J. E. Baker}, title = {Reducing Bias and Inefficiency in the Selection Algorithm}, pages = {14--21} } @Article{ balas.zemel:algorithm, author = {E. Balas and E. Zemel}, title = {An Algorithm for Large Zero--One Knapsack Problems}, journal = {Operations Research}, year = {1980}, volume = {28}, pages = {1132--1154} } @Book{ ballard.fullerton.ea:general, author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, title = {A General Equilibrium Model for Tax Policy Evaluation}, publisher = {The University of Chicago Press}, year = {1985}, series = {National Bureau of Economic Research Monograph} } @InProceedings{ balog.angelos.ea:dose, author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, title = {Dose Computation for a One-Dimensional Multileaf Collimator}, booktitle = {Proceedings of the XII International Conference on the Use of Computers in Radiation Therapy, Salt Lake City}, year = {1997}, editor = {D. D. Leavitt and G. Starkshall}, publisher = {Medical Physics Publishing}, address = {St. Louis, Missouri}, pages = {323--326} } @Article{ baraff:fast, author = {D. Baraff}, title = {Fast contact force computation for nonpenetrating rigid bodies}, journal = {Computer Graphics (Proceedings SIGRAPH)}, year = {1994}, pages = {23--34}, volume = {28} } @Article{ baraff:issues, author = {D. Baraff}, title = {Issues in computing contact forces for nonpenetrating rigid bodies}, journal = {Algorithmica}, volume = {10}, year = {1993}, pages = {292--352} } @Book{ barrett.berry.ea:templates, title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative Methods}, author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, year = {1994}, publisher = {SIAM}, address = {Philadelphia, Pennsylvania} } @Article{ bard:algorithm, author = {J. F. Bard}, title = {An Algorithm for Solving the General Bi--Level Programming Problem}, journal = {Mathematics of Operations Research}, year = {1983}, volume = {8}, pages = {260--272} } @Article{ bard:convex, author = {J. F. Bard}, title = {Convex Two-Level Optimization}, journal = {Mathematical Programming}, year = {1988}, volume = {40}, pages = {15--27} } @InCollection{ bard:eclectic, author = {Y. Bard}, title = {An Eclectic Approach to Nonlinear Programming}, booktitle = {Optimization}, publisher = {University of Queensland Press}, editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, year = {1972}, address = {St. Lucia, Queensland, Australia}, pages = {116--128} } @Article{ barnes:variation, author = {E. R. Barnes}, title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {174--182} } @Article{ bartels.golub:simplex, author = {R. H. Bartels and G. H. Golub}, title = {The Simplex Method of Linear Programming using {LU} Decomposition}, journal = {Communications of the Asociation for Computing Machinery}, year = {1969}, volume = {12}, pages = {266--268} } @Article{ barton.ivey:nelder, author = {R. Barton and J. S. Ivey}, title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, journal = {Management Science}, year = {1996}, volume = {42}, number = {7}, pages = {954--973} } @Article{ battiti:first-, author = {R. Battiti}, title = {First- and Second-Order Methods for Learning: Between Steepest Descent and {N}ewton's Method}, journal = {Neural Computation}, year = {1992}, volume = {4}, pages = {141--166} } @Article{ baudet:asynchronous, author = {G. M. Baudet}, title = {Asynchronous iterative methods for multiprocesors}, journal = {Journal of the Association for Computing Machinery}, year = {1978}, volume = {25}, pages = {226--244} } @InProceedings{ baum.haussler:what, author = {E. B. Baum and D. Haussler}, title = {What Size Net Gives Valid Generalization}, booktitle = {Advances in Neural Information Processing Systems I}, year = {1989}, editor = {D. S. Touretzky}, publisher = {Morgan Kaufmann}, address = {San Mateo, California}, pages = {81--90} } @Misc{ baum:private, author = {E. B. Baum}, title = {Private Communication}, year = {1992}, address = {NEC Research Institute, Princeton, New Jersey} } @Book{ bazaraa.sherali.ea:nonlinear, author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, title = {Nonlinear Programming}, edition = {Second}, publisher = {John Wiley and Sons}, address = {New York}, year = {1993} } @Book{ bazaraa.shetty:nonlinear, author = {M. S. Bazaraa and C. M. Shetty}, title = {Nonlinear Programming: Theory and Algorithms}, publisher = {John Wiley \& Sons}, year = {1979}, address = {New York, New York} } @Article{ beale:cycling, author = {E. M. L. Beale}, title = {Cycling in the Dual Simplex Method}, journal = {Naval Research Logistics Quarterly}, year = {1955}, volume = {2}, pages = {103--107} } @InProceedings{ becker.cun:improving, author = {S. Becker and Y. le Cun}, title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, booktitle = {Proceedings of 1988 Connectionist Models Summer School}, year = {1988}, editor = {D. S. Touretzky}, publisher = {Morgan Kaufmann}, address = {San Mateo, California}, pages = {29--37} } @Book{ ben-israel.ben-tal.ea:optimality, author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, year = {1981}, publisher = {John Wiley \& Sons}, address = {New York} } @Article{ ben-israel:newton-raphson, author = {A. Ben--Israel}, title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, journal = {Journal of Mathematical Analysis and its Applications}, year = {1966}, volume = {15}, pages = {243--252} } @Article{ ben-tal.melman.ea:curved, author = {A. Ben--Tal and A. Melman and J. Zowe}, title = {Curved Search Methods for Unconstrained Optimization}, journal = {Optimization}, year = {1990}, volume = {21}, pages = {669--695}, publisher = {John Wiley \& Sons}, address = {New York} } @InProceedings{ bennett.ferris.ea:genetic, crossref = {belew.booker:fourth}, author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, title = {A Genetic Algorithm for Database Query Optimization}, pages = {400--407}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, key = {19} } @Article{ bennett.mangasarian:bilinear, author = {K. P. Bennett and O. L. Mangasarian}, title = {Bilinear Separation of Two Sets in n-Space}, journal = {Computational Optimization and Applications}, year = {1993}, volume = {2}, pages = {207--227} } @Article{ bennett.mangasarian:multicategory, author = {K. P. Bennett and O. L. Mangasarian}, title = {Multicategory Separation via Linear Programming}, journal = {Optimization Methods and Software}, year = {1993}, volume = {3}, pages = {27--39} } @InProceedings{ bennett.mangasarian:neural, author = {K. P. Bennett and O. L. Mangasarian}, title = {Neural Network Training via Linear Programming}, booktitle = {Advances in Optimization and Parallel Computing}, year = {1992}, editor = {P. M. Pardalos}, publisher = {North Holland}, address = {Amsterdam}, pages = {56--67} } @Article{ bennett.mangasarian:robust, author = {K. P. Bennett and O. L. Mangasarian}, title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, journal = {Optimization Methods and Software}, year = {1992}, volume = {1}, pages = {23--34} } @Article{ bennett.mangasarian:serial, author = {K. P. Bennett and O. L. Mangasarian}, title = {Serial and Parallel Multicategory Separation}, journal = {SIAM Journal on Optimization}, year = {1994}, volume = {4}, pages = {722--734} } @TechReport{ bennett.wu.ea:support, author = {K. P. Bennett and D. Wu and L. Auslender}, title = {On Support Vector Decision Trees for Database Marketing}, institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, year = {1998}, optkey = {}, opttype = {RPI Math Report}, optnumber = {98-100}, optaddress = {Troy, New York}, optmonth = {}, optnote = {}, optannote = {} } @InProceedings{ bennett:decision, author = {K. P. Bennett}, title = {Decision Tree Construction Via Linear Programming}, booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science Society Conference}, year = {1992}, editor = {M. Evans}, address = {Utica, Illinois}, pages = {97--101} } @Book{ berge.ghouila-houri:programming, author = {C. Berge and A. Ghouila-Houri}, title = {Programming, Games and Transportation Networks}, year = {1965}, publisher = {John Wiley \& Sons}, address = {New York} } @Book{ berge:topological, author = {C. Berge}, title = {Topological Spaces}, year = {1963}, publisher = {McMillan}, address = {New York} } @TechReport{ berkelaar.jansen.ea:basis, author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, title = {Basis and Tripartition Identification for Quadratic Programming and Linear Complementarity Problems}, institution = {Department of Econometrics and Operations Research}, year = {1996}, address = {Erasmus University, Rotterdam, The Netherlands} } @Article{ bertsekas.baz:distributed, author = {D. P. Bertsekas and D. El Baz}, title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, journal = {SIAM Journal on Control and Optimization}, year = {1987}, volume = {25}, pages = {74--85} } @Article{ bertsekas.gafni:projection, author = {D. P. Bertsekas and E. M. Gafni}, title = {Projection Methods for Variational Inequalities with Application to the Traffic Assignment Problem}, journal = {Mathematical Programming Study}, year = {1982}, volume = {17}, pages = {139--159} } @Article{ bertsekas.hossein.ea:relaxation, author = {D. P. Bertsekas and P. Hossein and P. Tseng}, title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, journal = {SIAM Journal on Control and Optimization}, year = {1987}, volume = {25}, pages = {1219--1243} } @Unpublished{ bertsekas.tseng:partial, author = {D. P. Bertsekas and P. Tseng}, title = {Partial Proximal Minimization for Convex Programming}, year = {1991}, note = {Manuscript} } @Article{ bertsekas.tsitsiklis:analysis, author = {D. P. Bertsekas and J. N. Tsitsiklis}, title = {An Analysis of Stochastic Shortest Path Problems}, journal = {Mathematics of Operations Research}, year = {1991}, volume = {16}, pages = {580--595} } @Book{ bertsekas.tsitsiklis:parallel, author = {D. P. Bertsekas and J. N. Tsitsiklis}, title = {Parallel and Distributed Computation: Numerical Methods}, publisher = {Prentice-Hall, Inc}, year = {1989}, address = {Englewood Cliffs, New Jersey} } @Book{ bertsekas:constrained, author = {D. P. Bertsekas}, title = {Constrained Optimization and Lagrange Multiplier Methods}, year = {1982}, publisher = {Academic Press}, address = {New York} } @Book{ bertsekas:dynamic, author = {D. P. Bertsekas}, title = {Dynamic Programming and Optimal Control}, publisher = {Athena Scientific}, year = {1995}, address = {Belmont MA} } @Article{ bertsekas:enlarging, author = {D. P. Bertsekas}, title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained Optimization}, journal = {Journal of Optimization Theory and Applications}, year = {1982}, volume = {36}, pages = {221--252} } @Article{ bertsekas:goldstein-levitin-poljak, author = {D. P. Bertsekas}, title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, journal = {IEEE Transactions on Automatic Control}, year = {1976}, volume = {AC-21}, pages = {174--184} } @Article{ bertsekas:multiplier, author = {D. P. Bertsekas}, title = {Multiplier Methods: {A} Survey}, journal = {Automatica}, year = {1976}, volume = {12}, pages = {133--145} } @Article{ bertsekas:necessary, author = {D. P. Bertsekas}, title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, journal = {Mathematical Programming}, year = {1975}, volume = {9}, pages = {87--99} } @Book{ bertsekas:nonlinear, author = {D. P. Bertsekas}, title = {Nonlinear Programming}, publisher = {Athena Scientific}, year = {1995}, address = {Belmont, Massachusetts} } @Article{ bertsekas:projected, author = {Dimitri P. Bertsekas}, title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, journal = {SIAM Journal on Control and Optimization}, year = {1982}, volume = {20}, pages = {221--246} } @Article{ billups.dirkse.ea:comparison, author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, journal = {Computational Optimization and Applications}, year = {1997}, pages = {3--25}, volume = {7}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, key = {51} } @Article{ billups.ferris:convergence, author = {S. C. Billups and M. C. Ferris}, title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive Starting Points}, journal = {SIAM Journal on Optimization}, year = {1996}, volume = {6}, pages = {316--325}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, key = {34} } @TechReport{ billups.ferris:convergence*1, author = {S. C. Billups and M. C. Ferris}, title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting Points}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1993}, address = {Madison, Wisconsin}, number = {1180}, note = {Revised version in SIAM Journal on Optimization.} } @Article{ billups.ferris:qpcomp, author = {S. C. Billups and M. C. Ferris}, title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, year = {1997}, journal = {Mathematical Programming}, pages = {533--562}, volume = {76}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, key = {47} } @Article{ billups.ferris:solutions, author = {S. C. Billups and M. C. Ferris}, title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, journal = {Mathematics of Operations Research}, volume = {24}, pages = {219--236}, year = {1999}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, key = {42}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, type = {Mathematical Programming Technical Report}, number = {94--15} } @TechReport{ billups.murata.ea:users, author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of Heavy Water Nuclear Reactor Containments Under Accident Conditions}, institution = {SNL}, year = {1994}, month = jan, address = {Albuquerque, New Mexico}, number = {SAND91--1482} } @TechReport{ billups.speight.ea:nonmonotone, author = {S. C. Billups and A. L. Speight and L. T. Watson}, title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity Problems}, institution = {Department of Mathematics, University of Colorado}, year = {1999}, address = {Denver, Colorado} } @PhDThesis{ billups:algorithms, author = {S. C. Billups}, title = {Algorithms for Complementarity Problems and Generalized Equations}, school = {University of Wisconsin--Madison}, year = {1995}, address = {Madison, Wisconsin}, month = aug } @MastersThesis{ billups:augmented, author = {S. C. Billups}, title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, school = {Virginia Tech}, year = {1985}, address = {Blacksburg, Virginia} } @TechReport{ billups:homotopy, author = {S. C. Billups}, title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, institution = {Department of Mathematics, University of Colorado}, year = {1998}, address = {Denver, Colorado} } @Article{ billups:improving, author = {S. C. Billups}, title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using Proximal Perturbations}, year = {2000}, journal = {Mathematical Programming}, volume = {87}, pages = {153--176} } @Book{ birge.louveaux:introduction, author = {J. R. Birge and R. Louveaux}, title = {Introduction to Stochastic Programming}, publisher = {Springer}, address = {New York}, year = {1997} } @TechReport{ bischof.carle.ea:adifor, author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, title = {{ADIFOR} 2.0 User's Guide}, institution = {Argonne National Laboratory}, year = {1995}, address = {Argonne, Illinois}, number = {ANL/MCS--TM--192}, type = {Mathematics and Computer Science Division Report} } @Book{ bisschop.entriken:aimms, author = {J. Bisschop and R. Entriken}, title = {{AIMMS} -- The Modeling System}, year = {1993}, publisher = {Paragon Decision Technology}, address = {Haarlem, The Netherlands} } @Article{ bisschop.meeraus:development, author = {J. Bisschop and A. Meeraus}, title = {On the Development of a General Algebraic Modeling System in a Strategic Planning Environment}, journal = {Mathematical Programming Study}, year = {1982}, volume = {20}, pages = {1--29} } @Misc{ bixby.ceria.ea:miplib, author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, title = {{MIPLIB} 3.0}, howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} } @InProceedings{ bjorkman.klarbring.ea:sequential, author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. Sj{\"{o}}din}, title = {Sequential quadratic programming for non-linear elastic contact problems}, editor = {J. Herskovits}, booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural Systems}, volume = {2}, year = {1993}, pages = {301--308} } @Article{ bjorkman:path, author = {G. Bj{\"o}rkman}, title = {Path Following and Critical Points for Contact Problems}, journal = {Computational Mechanics}, volume = {10}, pages = {231--246}, year = {1992} } @Article{ bjorkman:solution, author = {G. Bj{\"o}rkman}, title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence of Linear Complementarity Problems}, journal = {International Journal for Numerical Methods in Engineering}, volume = {31}, pages = {1553--1566}, year = {1991} } @Article{ bland:pivot, author = {R. G. Bland}, title = {New Pivot Rules for the Simplex Method}, journal = {Mathematics of Operations Research}, year = {1977}, volume = {2}, pages = {103--107} } @Article{ block.levin:boundedness, author = {H. D. Block and S. A. Levin}, title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear Inequalities}, journal = {Proceedings of the American Mathematical Society}, year = {1970}, volume = {26}, pages = {229--235} } @Book{ bloomer:power, author = {J. Bloomer}, title = {Power Programming with {RPC}}, publisher = {O'Reilly and Associates, Inc.}, address = {Sebastopol, CA}, year = {1992} } @InProceedings{ blum.rivest:training, author = {A. Blum and R. L. Rivest}, title = {Training a 3-Node Neural Network is {NP}-Complete}, booktitle = {Advances in Neural Information Processing Systems I}, year = {1989}, editor = {D. S. Touretzky}, publisher = {Morgan Kaufmann}, address = {San Mateo, California}, pages = {494--501} } @InProceedings{ boehringer.ferris.ea:exemptions, author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results from a General Equilibrium Model for Six {EU} Countries}, key = {49}, booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, year = {1995} } @Article{ boender.kan:bayesian, author = {C. G. E. Boender and A. H. G. Rinooy Kan}, title = {Bayesian Stopping Rules for Global Optimization}, journal = {Mathematical Programming}, year = {1987}, volume = {37}, pages = {59--80} } @Article{ boggs:convergence, author = {P. T. Boggs}, title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares Problems}, journal = {Mathematics of Computation}, year = {1976}, volume = {30}, pages = {512--522} } @InProceedings{ bolzon.cochetti.ea:computing, author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, title = {On computing all solutions in decohesion}, booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th International Congress of Theoretical and Applied Mechanics}, year = {1996}, address = {Kyoto} } @InProceedings{ bolzon.maier.ea:holonomic, author = {G. Bolzon and G. Maier and F. Tin-Loi}, title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative study of mathematical programming approaches}, booktitle = {Fracture Mechanics of Concrete Structures}, editor = {F. H. Wittmann}, series = {Second International Conference on Fracture Mechanics of Concrete Structures (FRAMCOS 2)}, year = {1995}, publisher = {Aedificatio Publishers}, pages = {885--898} } @InProceedings{ bolzon.maier.ea:holonomic*1, author = {G. Bolzon and G. Maier and F. Tin-Loi}, title = {On holonomic structural analysis as a complementarity problem}, booktitle = {APCOM96, Seoul}, year = {1996} } @Article{ bolzon.maier.ea:multiplicity, author = {G. Bolzon and G. Maier and F. Tin-Loi}, title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, journal = {Computational Mechanics}, year = {1997}, volume = {19}, pages = {511--516} } @Article{ bongartz.conn.ea:cute, author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, title = {{CUTE}: Constrained and Unconstrained Testing Environment}, year = {1995}, journal = {{ACM} Transactions on Mathematical Software}, volume = {21}, pages = {123--160} } @Article{ boppana:eigenvalues, author = {R. Boppana}, title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, pages = {280--285}, year = {1987} } @Article{ bortfeld.kahler.ea:x-ray, author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, title = {{X}-ray field compensation with multileaf collimators}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1994}, volume = {28}, number = {3}, pages = {723--730} } @Article{ bortfeld.schlegel:optimization, author = {T. Bortfeld and W. Schlegel}, title = {Optimization of beam orientations in radiation therapy: some theoretical considerations}, journal = {Physics in Medicine and Biology}, year = {1993}, volume = {38}, number = {2}, pages = {291--304} } @Article{ borwein:stability, author = {J. M. Borwein}, title = {Stability and regular points of inequality systems}, journal = {Journal of Optimization Theory and Applications}, year = {1986}, volume = {48}, pages = {9--52} } @Article{ boyer:present, author = {A. L. Boyer}, title = {Present and Future Developments in Radiotherapy Treatment Units}, journal = {Seminars in Radiation Oncology}, year = {1995}, volume = {5}, number = {2}, pages = {146--155} } @Article{ bracken.mcgill:mathematical, author = {J. Bracken and J. T. McGill}, title = {Mathematical programs with optimization problems in the constraints}, journal = {Operations Research}, volume = {21}, year = {1973}, pages = {37--44} } @Article{ bradley.fayyad.ea:mathematical, author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, title = {Mathematical Programming for Data Mining: Formulations and Challenges}, journal = {INFORMS Journal on Computing}, year = {1999}, volume = {11}, pages = {217--238} } @TechReport{ bradley.mangasarian.ea:clustering, author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, title = {Clustering via Concave Minimization}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1996}, type = {Mathematical Programming Technical Report}, number = {96-03}, address = {Madison, Wisconsin} } @TechReport{ bradley.mangasarian.ea:feature, author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, title = {Feature Selection via Mathematical Programming}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1995}, type = {Mathematical Programming Technical Report}, number = {95-21}, address = {Madison, Wisconsin} } @Article{ bradley.mangasarian:massive, author = {P. S. Bradley and O. L. Mangasarian}, title = {Massive Data Discrimination via Linear Support Vector Machines}, year = {2000}, journal = {Optimization Methods and Software}, volume = {13}, pages = {1-10} } @PhDThesis{ brady:condition, author = {L. Brady}, title = {Condition Constants for Solutions of Convex Inequalities}, year = {1988}, address = {Madison, Wisconsin}, school = {Computer Sciences Department, University of Wisconsin} } @Article{ braess:uber, author = {D. Braess}, title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, journal = {Unternehmensforschung}, year = {1968}, volume = {12}, pages = {258--268} } @Article{ brahme:optimization, author = {A. Brahme}, title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1993}, volume = {25}, pages = {373--375} } @Article{ brahme:stationary, author = {A. Brahme}, title = {Optimization of stationary and moving beam radiation therapy techniques}, journal = {Radiother. Oncol.}, year = {1988}, volume = {12}, pages = {129--140} } @InCollection{ brahme:treatment, author = {A. Brahme}, title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, booktitle = {Radiation Therapy Physics}, publisher = {Springer-Verlag}, year = {1995}, editor = {A. R. Smith}, address = {Berlin}, pages = {209--246} } @TechReport{ branch:getting, author = {M. A. Branch}, title = {Getting {CUTE} with {M}atlab}, institution = {Cornell University}, year = {1994}, type = {Cornell Theory Center Report}, number = {CTC94TR194}, address = {Ithaca, New York} } @Article{ brearley.mitra.ea:analysis, author = {A. Brearley and G. Mitra and H. Williams}, title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex Algorithm}, journal = {Mathematical Programming}, year = {1975}, volume = {8}, pages = {54--83} } @Article{ bredensteiner.bennett:feature, author = {E. Bredensteiner and K. Bennett}, title = {Feature Minimization within Decision Trees}, journal = {Computational Optimization and Applications}, year = {1998}, volume = {10}, pages = {111--126} } @Article{ bregman:relaxation, author = {L. M. Bregman}, title = {The Relaxation Method of Finding the Common Point of Convex Sets and its Application to the Solution of Problems in Convex Programming}, journal = {USSR Computational Mathematics and Mathematical Physics}, year = {1967}, volume = {7}, pages = {200--217} } @Book{ brenner.hall:making, author = {D. J. Brenner and E. J. Hall}, title = {Making the Radiation Therapy Decision}, publisher = {Contemporary Books}, year = {1996}, address = {Chicago, IL} } @Book{ brent:algorithms, author = {R. P. Brent}, title = {Algorithms for Minimization without Derivatives}, publisher = {Prentice-Hall, Inc}, year = {1973}, address = {Englewood Cliffs, New Jersey} } @Article{ brewster.mohan.ea:three, author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, title = {Three dimensional conformal treatment planning with multileaf collimators}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1995}, volume = {33}, number = {5}, pages = {1081--1089} } @Article{ brezis.lions:produits, author = {H. Br\'{e}zis and P.--L. Lions}, title = {Produits Infinis de Resolvantes}, journal = {Israel Journal of Mathematics}, year = {1978}, volume = {29}, pages = {329--345} } @Book{ brezis:operateurs, author = {H. Br\'{e}zis}, title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les Espaces de Hilbert}, publisher = {North-Holland}, address = {Amsterdam}, year = {1973} } @Book{ brooke.kendrick.ea:gams, author = {A. Brooke and D. Kendrick and A. Meeraus}, title = {{GAMS}: {A} User's Guide}, year = {1988}, publisher = {The Scientific Press}, address = {South San Francisco, CA} } @Article{ brown.demarzo.ea:computing, author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, title = {Computing Equilibria when Asset Markets Are Incomplete}, journal = {Econometrica}, year = {1996}, volume = {64}, pages = {1--28} } @Article{ bruck:iterative, author = {R. E. Bruck}, title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators in {H}ilbert Space}, journal = {Bulletin of the American Mathematical Society}, year = {1975}, volume = {81}, pages = {890--892} } @Article{ bunch.parlett:direct, author = {J. R. Bunch and B. N. Parlett}, title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, journal = {SIAM Journal on Numerical Analysis}, year = {1971}, volume = {8}, pages = {639--655} } @Article{ burachik.iusem.ea:enlargement, author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, year = {1997}, journal = {Set-Valued Analysis, forthcoming} } @TechReport{ burachik.iusem:generalized, author = {R. S. Burachik and A. N. Iusem}, title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity Problem}, institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, year = {1995}, type = {Working Paper}, address = {Rio de Janeiro} } @Article{ burachik.iusem:generalized*1, author = {R. S. Burachik and A. N. Iusem}, title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in {A} {H}ilbert Space}, year = {1998}, journal = {SIAM Journal on Optimization}, volume = {8}, pages = {197--216} } @Article{ burdakov:globally, author = {O. P. Burdakov}, title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems of Nonlinear Equations}, journal = {Soviet Mathematics Doklady}, year = {1980}, volume = {22}, pages = {376--379} } @Article{ burges:tutorial, author = {C. J. C. Burges}, title = {A Tutorial on Support Vector Machines for Pattern Recognition}, journal = {Data Mining and Knowledge Discovery}, volume = {2}, number = {2}, pages = {121-167}, year = {1998} } @Article{ burke.ferris.ea:clarke, author = {J. V. Burke and M. C. Ferris and M. Qian}, title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, journal = {Journal of Mathematical Analysis and its Applications}, year = {1992}, volume = {166}, pages = {199--213}, key = {16} } @Unpublished{ burke.ferris.ea:least, author = {J. V. Burke and M. C. Ferris and L. Qi}, title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, year = {1994}, month = mar, note = {Manuscript}, key = {999} } @Article{ burke.ferris:characterization, author = {J. V. Burke and M. C. Ferris}, title = {Characterization of Solution Sets of Convex Programs}, journal = {Operations Research Letters}, year = {1991}, volume = {10}, pages = {57--60}, key = {10} } @Article{ burke.ferris:gauss-newton, author = {J. V. Burke and M. C. Ferris}, title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, journal = {Mathematical Programming}, year = {1995}, volume = {71}, pages = {179--194}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, key = {32} } @Article{ burke.ferris:weak, author = {J. V. Burke and M. C. Ferris}, title = {Weak Sharp Minima in Mathematical Programming}, journal = {SIAM Journal on Control and Optimization}, year = {1993}, volume = {31}, pages = {1340--1359}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, key = {23} } @Article{ burke.more.ea:convergence, author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, title = {Convergence Properties of Trust Region Methods for Linear and Convex Constraints}, journal = {Mathematical Programming}, year = {1990}, volume = {47}, pages = {305--336} } @Article{ burke.more:exposing, author = {J. V. Burke and J. J. Mor\'{e}}, title = {Exposing Constraints}, journal = {SIAM Journal on Optimization}, year = {1994}, volume = {4}, pages = {573--595} } @Article{ burke.more:identification, author = {J. V. Burke and J. J. Mor\'{e}}, title = {On the Identification of Active Constraints}, journal = {SIAM Journal on Numerical Analysis}, year = {1988}, volume = {25}, pages = {1197--1211} } @Article{ burke.poliquin:optimality, author = {J. V. Burke and R. A. Poliquin}, title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, journal = {Mathematical Programming}, year = {1992}, volume = {57}, pages = {103--120} } @Article{ burke.tseng:unified, author = {J. V. Burke and P. Tseng}, title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, journal = {SIAM Journal on Optimization}, year = {1996}, volume = {6}, pages = {265--282} } @Article{ burke.xu:global, author = {J. V. Burke and S. Xu}, title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for Linear Complementarity Problems}, year = {1998}, journal = {Mathematics of Operations Research}, volume = {23}, pages = {719--735} } @TechReport{ burke:algorithms, author = {J. V. Burke}, title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and Inequalities that have both Global and Quadratic Convergence Properties}, institution = {Argonne National Laboratory}, year = {1985}, address = {Argonne, Illinois}, number = {ANL/MCS--TM--54}, type = {Mathematics and Computer Science Division Report} } @Article{ burke:descent, author = {J. V. Burke}, title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, journal = {Mathematical Programming}, year = {1985}, volume = {33}, pages = {260--279} } @Article{ burke:exact, author = {J. V. Burke}, title = {An Exact Penalization Viewpoint of Constrained Optimization}, journal = {SIAM Journal on Control and Optimization}, year = {1991}, volume = {29}, pages = {968--998} } @Article{ burke:identification, author = {J. V. Burke}, title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, journal = {SIAM Journal on Numerical Analysis}, year = {1990}, volume = {27}, pages = {1081--1102} } @Article{ burke:robust, author = {J. V. Burke}, title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, journal = {SIAM Journal on Optimization}, year = {1992}, volume = {2}, pages = {325--347} } @Article{ burke:second, author = {J. V. Burke}, title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, journal = {Mathematical Programming}, year = {1987}, volume = {38}, pages = {287--302} } @Article{ burke:sequential, author = {J. V. Burke}, title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical Programs}, journal = {Journal of Mathematical Analysis and its Applications}, year = {1989}, volume = {139}, pages = {319--351} } @Article{ burman.kutcher.ea:fitting, author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1991}, optvolume = {21}, optpages = {123-135} } @TechReport{ busovaca:handling, author = {S. Busovaca}, title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, institution = {University of Waterloo}, year = {1985}, address = {Ontario}, number = {CS85 34}, type = {Technical Report} } @Article{ butler.martin:method, author = {T. Butler and A. V. Martin}, title = {On a Method of {C}ourant for Minimizing Functionals}, journal = {Journal of Mathematical Physics}, year = {1962}, volume = {41}, pages = {291--299} } @Article{ calamai.more:projected, author = {P. H. Calamai and J. J. Mor\'{e}}, title = {Projected Gradient Methods for Linearly Constrained Problems}, journal = {Mathematical Programming}, year = {1987}, volume = {39}, pages = {93--116} } @Article{ cao.ferris:genetic, author = {M. Cao and M. C. Ferris}, title = {Genetic Algorithms in Optimization}, journal = {Journal of Undergraduate Mathematics and its Applications}, year = {1991}, volume = {12}, pages = {81--90}, key = {17} } @Article{ cao.ferris:interior, author = {M. Cao and M. C. Ferris}, title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, journal = {Journal of Optimization Theory and Applications}, year = {1994}, volume = {83}, pages = {269--283}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, key = {28} } @Article{ cao.ferris:lineality, author = {M. Cao and M. C. Ferris}, title = {Lineality Removal for Copositive--Plus Normal Maps}, year = {1995}, volume = {2}, pages = {1--10}, journal = {Communications on Applied Nonlinear Analysis}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, key = {38} } @Article{ cao.ferris:pc, author = {M. Cao and M. C. Ferris}, title = {{$P_C$} Matrices and the Linear Complementarity Problem}, journal = {Linear Algebra and Its Applications}, year = {1996}, volume = {246}, pages = {299--312}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, key = {37} } @Article{ cao.ferris:pivotal, author = {M. Cao and M. C. Ferris}, title = {A Pivotal Method for Affine Variational Inequalities}, journal = {Mathematics of Operations Research}, year = {1996}, volume = {21}, pages = {44--64}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, key = {29} } @PhDThesis{ cao:piecewise, author = {M. Cao}, title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, school = {Computer Sciences Department, University of Wisconsin}, year = {1994}, address = {Madison, Wisconsin}, note = {Technical Report 1210} } @Article{ caroe.schultz:dual, author = {C. C. Car{\o}e and R. Schultz}, title = {Dual Decomposition in Stochastic Integer Programming}, journal = {Operations Research Letters}, volume = {24}, pages = {37-45}, year = {1999} } @Article{ carol.targovnik.ea:initial, author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} conformal radiation therapy system}, journal = {Stereotactic and Functional Neurosurgery}, year = {1996}, volume = {66}, pages = {30--34} } @Article{ carolan.hill.ea:empirical, author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. Wichmann}, title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift Applications}, journal = {Operations Research}, year = {1990}, volume = {38}, pages = {240--248} } @Article{ carroll:created, author = {C. W. Carroll}, title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained Systems}, journal = {Operations Research}, year = {1961}, volume = {9}, pages = {169--184} } @PhDThesis{ carroll:operations, author = {C. W. Carroll}, title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping Process}, year = {1959}, address = {Appleton, Wisconsin}, school = {Institute of Paper Chemistry} } @TechReport{ casanova.dongarra:netsolve, author = {H. Casanova and J. Dongarra}, title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, institution = {University of Tennessee}, year = {1996}, type = {Technical Report} } @TechReport{ cavalier.soyster:computational, author = {T. M. Cavalier and A. L. Soyster}, title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, institution = {Pennsylvania State University}, year = {1985}, address = {Pennsylvania}, number = {85-105}, type = {ISME Working Paper} } @TechReport{ censor.iusem.ea:interior-point, author = {Y. Censor and A. N. Iusem and S. A. Zenios}, title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality Problem with Paramonotone Operators}, institution = {University of Haifa}, year = {1994}, type = {Working Paper} } @Article{ censor.lent:iterative, author = {Y. Censor and A. Lent}, title = {An Iterative Row-Action Method for Interval Convex Programming}, journal = {Journal of Optimization Theory and Applications}, year = {1981}, volume = {34}, pages = {275--291} } @InCollection{ censor.pierro.ea:iterative, author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume XXIV}, publisher = {Banach Center}, year = {1987}, editor = {A. J. Wakulicz}, address = {Warsaw, Poland} } @Article{ censor.segman:block-iterative, author = {Y. Censor and J. Segman}, title = {On Block-Iterative Entropy Maximization}, journal = {Journal of Information and Optimization Science}, year = {1987}, volume = {8}, pages = {275--291} } @Article{ censor.zenios:proximal, author = {Y. Censor and S. A. Zenios}, title = {The Proximal Minimization Algorithm with ${D}$-functions}, journal = {Journal of Optimization Theory and Applications}, year = {1992}, volume = {73}, pages = {451--464} } @Article{ censor:parallel, author = {Yair Censor}, title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation Therapy}, journal = {Mathematical Programming}, year = {1988}, volume = {42}, pages = {307--325} } @Article{ censor:row-action, author = {Yair Censor}, title = {Row-action Methods for Huge and Sparse Systems and their Applications}, journal = {SIAM Review}, year = {1981}, volume = {23}, pages = {444--466} } @Article{ chajakis.zenios:synchronous, author = {E. D. Chajakis and S. A. Zenios}, title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for Nonlinear Network Optimization}, journal = {Parallel Computing}, year = {1990}, note = {To appear} } @Article{ chamberlain.powell.ea:watchdog, author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained Optimization}, journal = {Mathematical Programming Study}, year = {1982}, volume = {16}, pages = {1--17} } @Article{ chan.pang:generalized, author = {D. Chan and J. S. Pang}, title = {The Generalized Quasi-Variational Inequality Problem}, journal = {Mathematics of Operations Research}, volume = {7}, pages = {211--222}, year = {1982} } @Article{ charalambous:nonlinear, author = {C. Charalambous}, title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, journal = {Mathematical Programming}, year = {1977}, volume = {12}, pages = {195--225} } @Article{ charnes.cooper.ea:duality, author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, title = {Duality, {H}aar Programs and Finite Sequence Spaces}, journal = {Proceedings of the National Academy of Sciences of the United States}, year = {1962}, pages = {783--786} } @Book{ charnes.cooper.ea:introduction, author = {A. Charnes and W. W. Cooper and A. Henderson}, title = {An Introduction to Linear Programming}, year = {1953}, publisher = {John Wiley \& Sons}, address = {New York} } @TechReport{ charnes.semple:practical, author = {A. Charnes and J. Semple}, title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, institution = {CCS}, year = {1991}, address = {Austin, Texas}, number = {663}, type = {Research Report} } @InProceedings{ charnes:fundamental, author = {A. Charnes}, title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, booktitle = {Computer and Information Sciences}, year = {1964}, editor = {J. T. Lou and R. H. Wilcox}, publisher = {Spartan Books}, address = {Washington, D.C.}, pages = {67--74} } @TechReport{ chen.chen.ea:penalized, author = {B. Chen and X. Chen and C. Kanzow}, title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and Numerical Results}, institution = {Institute of Applied Mathematics, University of Hamburg}, year = {1997}, type = {Preprint}, number = {126}, address = {Hamburg, Germany} } @Article{ chen.chen:global, author = {B. Chen and X. Chen}, title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + ${R}_0$ {NCP} or Monotone {NCP}}, journal = {SIAM Journal on Optimization}, year = {1999}, volume = {9}, pages = {624--645} } @Article{ chen.ferris.ea:fatcop, author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming Solver}, journal = {Annals of Operations Research, forthcoming}, year = {2000}, url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, key = {89}, type = {Data Mining Institute Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {99-11} } @TechReport{ chen.ferris:fatcop, author = {Q. Chen and M. C. Ferris}, title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, year = {1999}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, number = {99-05}, key = {81}, annote = {Submitted to {\em SIOPT}} } @Article{ chen.florian:nonlinear, author = {Y. Chen and M. Florian}, title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and Optimality Conditions}, journal = {Optimization}, year = {1995}, volume = {32}, pages = {193--209} } @TechReport{ chen.florian:o-d, author = {Y. Chen and M. Florian}, title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and optimality conditions}, type = {Publication}, number = {CRT-94-56}, institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, address = {Montr\'eal, Canada}, year = {1994} } @Article{ chen.harker:continuation, author = {B. Chen and P. T. Harker}, title = {A Continuation Method for Monotone Variational Inequalities}, journal = {Mathematical Programming}, volume = {69}, pages = {237--253}, year = {1995} } @Article{ chen.harker:non-interior, author = {B. Chen and P. T. Harker}, title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, journal = {SIAM Journal on Matrix Analysis and Applications}, year = {1993}, volume = {14}, pages = {1168--1190} } @Article{ chen.harker:smooth, author = {B. Chen and P. T. Harker}, title = {Smooth Approximations to Nonlinear Complementarity Problems}, journal = {SIAM Journal on Optimization}, year = {1997}, volume = {7}, pages = {403--420} } @Article{ chen.mangasarian:class, author = {Chunhui Chen and O. L. Mangasarian}, title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, journal = {Computational Optimization and Applications}, year = {1996}, volume = {5}, pages = {97--138} } @Article{ chen.mangasarian:smoothing, author = {Chunhui Chen and O. L. Mangasarian}, title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, journal = {Mathematical Programming}, year = {1995}, volume = {78}, pages = {51--70} } @Article{ chen.nashed.ea:convergence, author = {X. Chen and Z. Nashed and L. Qi}, title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations using Adaptive Outer Inverses}, year = {1997}, journal = {SIAM Journal on Optimization}, volume = {7}, pages = {445--462} } @Article{ chen.qi.ea:global, author = {X. Chen and L. Qi and D. Sun}, title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its Application to General Box Constrained Variational Inequalities}, year = {1998}, journal = {Mathematics of Computation}, volume = {67}, pages = {519--540} } @Article{ chen.teboulle:convergence, author = {G. Chen and M. Teboulle}, title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman Functions}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, pages = {538--543} } @Article{ chen.ye:homotopy-smoothing, author = {X.~Chen and Y.~Ye}, title = {On Homotopy-Smoothing Methods for Variational Inequalities}, year = {1999}, journal = {SIAM Journal on Control and Optimization}, volume = {37}, pages = {589--616} } @PhDThesis{ chen:forward-backward, author = {G. H.--G. Chen}, title = {Forward--Backward Splitting Techniques: Theory and Applications}, school = {University of Washington}, year = {1994} } @PhDThesis{ chen:smoothing, author = {Chunhui Chen}, title = {Smoothing Methods in Mathematical Programming}, school = {Computer Sciences Department, University of Wisconsin}, year = {1995}, address = {Madison, Wisconsin}, note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, annote = {Mathematical Programming Technical Report 95-12} } @Book{ cheney:introduction, author = {E. W. Cheney}, title = {Introduction to Approximation Theory}, year = {1966}, publisher = {McGraw--Hill}, address = {New York} } @Article{ cho.kuterdem.ea:spherical, author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, title = {A spherical dose model for radiosurgery treatment planning}, journal = {Physics in Medicine and Biology}, year = {1998}, volume = {43}, pages = {3145--3148} } @Article{ cho.lee.ea:optimization, author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, title = {Optimization of intensity modulated beams with volume constraints using two methods: cost function minimization and projection onto convex sets}, journal = {Medical Physics}, year = {1998}, volume = {25}, number = {4}, pages = {435--443} } @Article{ choi.desarbo.ea:product, author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, title = {Product Positioning Under Price Competition}, journal = {Management Science}, year = {1990}, volume = {36}, pages = {175--199} } @Article{ chow.mallet-parret.ea:finding, author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability One}, journal = {Mathematics of Computing}, year = {1978}, volume = {32}, pages = {887--899} } @Article{ christopherson:mathematical, author = {D. G. Christopherson}, title = {A new mathematical method for the solution of film lubrication problems}, journal = {Proceedings of the Institute of Mechanical Engineers}, volume = {146}, year = {1941}, pages = {126--135} } @TechReport{ chun.lee.ea:implementation, author = {B. J. Chun and S. J. Lee and S. M. Robinson}, title = {An Implementation of the Bundle Decomposition Algorithm}, institution = {Department of Industrial Engineering, University of Wisconsin}, year = {1991}, address = {Madison, Wisconsin}, number = {91-6} } @Article{ chung:np-completeness, author = {S.--J. Chung}, title = {{NP}-Completeness of the Linear Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, volume = {60}, year = {1989}, pages = {393--399} } @Book{ chvatal:linear, author = {V. Chv\'atal}, title = {Linear Programming}, year = {1983}, publisher = {W. H. Freeman and Company}, address = {New York} } @Book{ ciarlet:finite, author = {P. G. Ciarlet}, title = {The Finite Element Method for Elliptic Problems}, year = {1978}, publisher = {North-Holland}, address = {New York} } @Article{ cinquini.contro:optimal, author = {C. Cinquini and R. Contro}, title = {Optimal design of beams discretized by elastic plastic finite element}, journal = {Computers \& Structures}, volume = {20}, year = {1985}, pages = {475--585} } @Book{ clarke:optimization, author = {F. H. Clarke}, title = {Optimization and Nonsmooth Analysis}, year = {1983}, publisher = {John Wiley \& Sons}, address = {New York} } @InProceedings{ cleveland.smith:genetic, crossref = {schaeffer:third}, author = {G. A. Cleveland and S. F. Smith}, title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, pages = {160--169} } @Book{ cochran:sampling, author = {W. Cochran}, title = {Sampling Techniques}, publisher = {Wiley}, year = {1977}, address = {New York}, edition = {Third} } @Article{ coleman.conn:nonlinear, author = {T. F. Coleman and A. R. Conn}, title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, journal = {Mathematical Programming}, year = {1982}, volume = {24}, pages = {123--136} } @Article{ coleman.conn:nonlinear*1, author = {T. F. Coleman and A. R. Conn}, title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, journal = {Mathematical Programming}, year = {1982}, volume = {24}, pages = {137--161} } @TechReport{ coleman.liu:interior, author = {T. F. Coleman and J. Liu}, title = {An interior newton method for quadratic programming}, institution = {Dept. of Computer Science, Cornell University}, year = {1993}, number = {TR 93-1388}, address = {Ithaca, NY}, month = oct } @Article{ coleman.more:estimation, author = {T. F. Coleman and J. J. Mor\'{e}}, title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, journal = {SIAM Journal on Numerical Analysis}, year = {1983}, volume = {20}, pages = {187--209} } @Manual{ coleman.verma:admat, author = {T. F. Coleman and A. Verma}, title = {{ADMAT} User Guide}, year = {2000} } @TechReport{ colville:comparative, author = {A. R. Colville}, title = {A Comparative Study on Nonlinear Programming Codes}, institution = {IBM New York Scientific Center}, year = {1968}, month = jun, number = {320--2949}, type = {Technical Report} } @Article{ comi.maier:extremum, author = {C. Comi and G. Maier}, title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, journal = {European Journal Mechanics A/Solids}, volume = {9}, year = {1990}, pages = {563--585} } @Misc{ condon.dahl.ea:implementing, author = {T. Condon and H. Dahl and S. Devarajan}, title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon Model}, year = {1987}, howpublished = {{DRD} Discussion Paper 290}, note = {The World Bank, Washington DC} } @Book{ conn.gould.ea:lancelot, author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization (Release {A})}, year = {1992}, publisher = {Springer Verlag}, address = {Heidelberg, Berlin}, series = {Springer Series in Computational Mathematics}, number = {17} } @Article{ conn.gould.ea:numerical, author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale Nonlinear Optimization}, journal = {Mathematical Programming}, year = {1996}, volume = {75}, pages = {73--110} } @Book{ cgt, author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, title = {Trust-Region Methods}, year = {2000}, publisher = {SIAM}, address = {Philadelphia, Pennsylvania} } @InCollection{ conn.toint:algorithm, author = {A. R. Conn and Ph. L. Toint}, title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free Optimization}, booktitle = {Nonlinear Optimization and Applications}, editor = {G. Di Pillo and F. Giannessi}, year = {1996}, publisher = {Plenum Press}, address = {New York} } @Article{ conry.seireg:mathematical, author = {T. F. Conry and A. Seireg}, title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, journal = {{ASME} Transactions Journal of Applied Mechanics}, volume = {93}, year = {1971}, pages = {387--392} } @Article{ cook.gerards.ea:sensitivity, author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, title = {Sensitivity Results in Integer Linear Programming}, journal = {Mathematical Programming}, year = {1986}, volume = {34}, pages = {251--264} } @Article{ cook:taxonomy, author = {S. A. Cook}, title = {A Taxonomy of Problems with Fast Parallel Algorithms}, journal = {Information and Control}, year = {1985}, volume = {64}, pages = {2--22} } @Article{ cooper:gradient, author = {R. E. M. Cooper}, title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, journal = {Radiology}, year = {1978}, volume = {128}, pages = {235--243} } @Article{ cormack:problem, author = {A. M. Cormack}, title = {A problem in roatation therapy with x-rays}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1987}, volume = {13}, pages = {623--630} } @Article{ cormack:problem*1, author = {A. M. Cormack}, title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of symmetry}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1987}, volume = {13}, pages = {1921--1925} } @Article{ cottle.dantzig:complementary, author = {R. W. Cottle and G. B. Dantzig}, title = {Complementary Pivot Theory of Mathematical Programming}, journal = {Linear Algebra and Its Applications}, year = {1968}, volume = {1}, pages = {103--125} } @Article{ cottle.dantzig:generalization, author = {R. W. Cottle and G. B. Dantzig}, title = {A Generalization of the Linear Complementarity Problem}, journal = {Journal of Combinatorial Theory}, year = {1970}, volume = {8}, pages = {79--90} } @Book{ cottle.giannessi.ea:variational, author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, year = {1980}, publisher = {John Wiley \& Sons}, address = {New York} } @InCollection{ cottle.goheen:special, author = {R. W. Cottle and M. S. Goheen}, title = {A Special Class of Large Quadratic Programs}, pages = {361--390}, crossref = {mangasarian.meyer.ea:nonlinear*3} } @Article{ cottle.golub.ea:solution, author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, title = {On the Solution of Large Structured Complementarity Problems: The Block Partitioned Case}, journal = {Applied Mathematics and Optimization}, year = {1978}, volume = {4}, pages = {347--363} } @Book{ cottle.pang.ea:linear, author = {R. W. Cottle and J. S. Pang and R. E. Stone}, title = {The Linear Complementarity Problem}, year = {1992}, publisher = {Academic Press}, address = {Boston} } @Article{ cottle.pang.ea:sufficient, author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, title = {Sufficient Matrices and the Linear Complementarity Problem}, journal = {Linear Algebra and Its Applications}, year = {1989}, volume = {114/115}, pages = {231--249} } @PhDThesis{ cottle:nonlinear, author = {R. W. Cottle}, title = {Nonlinear programs with positively bounded {J}acobians}, school = {Department of Mathematics, University of California}, year = {1964}, address = {Berkeley, California} } @Article{ cottle:nonlinear*1, author = {R. W. Cottle}, title = {Nonlinear programs with positively bounded {J}acobians}, journal = {Journal of the Society for Industrial and Applied Mathematics}, volume = {14}, year = {1966}, pages = {147--158} } @InCollection{ cottle:principal, author = {R. W. Cottle}, title = {The principal pivoting method of quadratic programming}, booktitle = {Mathematics of the Decision Sciences, Part 1}, publisher = {American Mathematical Society}, editor = {G. B. Dantzig and Jr. A. F. Veinott}, address = {Providence, Rhode Island}, year = {1968}, pages = {144--162} } @Unpublished{ courant:calculus, author = {R. Courant}, title = {Calculus of Variations and Supplementary Notes and Exercises}, year = {1956}, note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, New York University} } @Article{ courant:variational, author = {R. Courant}, title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, journal = {Bulletin of the American Mathematical Society}, year = {1943}, volume = {49}, pages = {1--23} } @Book{ cristianini.shawe-taylor:introduction, author = {N. Cristianini and J. Shawe-Taylor}, title = {An Introduction to Support Vector Machines}, publisher = {Cambridge University Press}, address = {Cambridge}, year = {2000} } @Article{ cromme:strong, author = {L. Cromme}, title = {Strong Uniqueness}, journal = {Numerische Mathematik}, year = {1978}, volume = {29}, pages = {179--193} } @Article{ crowder.johnson.ea:solving, author = {H. Crowder and E. L. Johnson and M. W. Padberg}, title = {Solving Large Scale Zero-One Linear Programming Problems}, journal = {Operations Research}, year = {1983}, volume = {31}, pages = {803--834} } @Article{ cryer.dempster:equivalence, author = {C. W. Cryer and M. A. H. Dempster}, title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector Lattice {H}ilbert Spaces}, journal = {SIAM Journal on Control and Optimization}, year = {1980}, volume = {18}, pages = {76--89} } @Article{ cryer:method, author = {C. W. Cryer}, title = {The method of {C}hristopherson for solving free boundary problems for infinite journal bearings by means of finite differences}, journal = {Mathematics of Computation}, volume = {25}, year = {1971}, pages = {435--553} } @Article{ cryer:solution, author = {C. W. Cryer}, title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, journal = {SIAM Journal on Control and Optimization}, year = {1971}, volume = {9}, pages = {385--392} } @Article{ cryer:solution*1, author = {C. W. Cryer}, title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, journal = {SIAM Journal on Control}, year = {1971}, volume = {9}, pages = {385--392} } @Manual{ culler:split-c, author = {D. Culler}, title = {The Split--{C} Programming Language}, organization = {Computer Science Department, University of California, Berkeley} } @InProceedings{ cun.denker.ea:optimal, author = {Y. le Cun and J. S. Denker and S. A. Solla}, title = {Optimal Brain Damage}, booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, year = {1990}, editor = {D. S. Touretzky}, publisher = {Morgan Kaufmann}, address = {San Mateo, California}, pages = {598--605} } @TechReport{ czyzyk.mehrotra.ea:pcx, author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, title = {{PCx} Users Guide}, institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern University}, year = {1996}, type = {Technical Report}, number = {OTC 96/01} } @TechReport{ czyzyk.mesnier.ea:network-enabled, address = {Argonne, Illinois}, author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, institution = {Argonne National Laboratory}, number = {MCS-P615-0996}, title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, type = {Preprint}, year = {1996} } @Article{ czyzyk.wisniewski.ea:optimization, title = {Optimization Case Studies in the {NEOS} Guide}, author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, journal = {SIAM Review}, volume = {41}, pages = {148--163}, year = {1999} } @Article{ dai.laan.ea:simplicial, author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded Polyhedron}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {151--165} } @Article{ dai.talman:linear, author = {Y. Dai and D. Talman}, title = {Linear Stationary Point Problems on Unbounded Polyhedra}, journal = {Mathematics of Operations Research}, year = {1993}, pages = {635--644} } @Book{ daniel:approximate, author = {J. W. Daniel}, title = {The approximate minimization of functionals}, year = {1971}, publisher = {Prentice-Hall, Inc}, address = {Englewood Cliffs, New Jersey} } @Article{ danskin:theory, author = {J. M. Danskin}, title = {The Theory of Min--Max, with Applications}, journal = {SIAM Journal on Applied Mathematics}, year = {1964}, volume = {14}, pages = {641--664} } @Book{ danskin:theory*1, author = {J. M. Danskin}, title = {The Theory of Min--Max}, year = {1967}, publisher = {Springer-Verlag}, address = {New York} } @InCollection{ dantzig.cottle:positive, author = {G. B. Dantzig and R. W. Cottle}, title = {Positive (semi-)definite programming}, booktitle = {Nonlinear Programming}, publisher = {North-Holland}, editor = {J. Abadie}, address = {Amsterdam}, year = {1967}, pages = {55--73} } @Article{ dantzig.manne:complementarity, author = {G. B. Dantzig and A. S. Manne}, title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant Proportions}, journal = {Journal of Economic Theory}, year = {1974}, volume = {9}, pages = {312--323} } @Article{ dantzig.wolfe:decomposition, author = {G. B. Dantzig and P. Wolfe}, title = {Decomposition Principle for Linear Programs}, journal = {Operations Research}, year = {1960}, volume = {8}, pages = {101--111} } @Book{ dantzig:linear, author = {G. B. Dantzig}, title = {Linear Programming and Extensions}, year = {1963}, publisher = {Princeton University Press}, address = {Princeton, New Jersey} } @Manual{ dash:xpress-mp, title = {{XPRESS-MP} User Guide}, organization = {Dash Associates}, address = {Blisworth House, Blisworth, Northants, UK}, note = {http://www.dashopt.com/} } @Book{ davis:handbook, author = {L. D. Davis}, title = {The Handbook of Genetic Algorithms}, year = {1990}, publisher = {Van Nostrand Reinhold} } @TechReport{ davis:users, author = {T. A. Davis}, title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, type = {{Technical Report}}, year = {1993}, institution = {Computer and Information Sciences Department, University of Florida}, address = {Gainesville, Florida} } @TechReport{ dax:computation, author = {A. Dax}, title = {The Computation of Descent Directions at Degenerate Points}, institution = {Hydrological Service of Israel}, year = {1985}, type = {Technical Report} } @Article{ dax:note, author = {A. Dax}, title = {A Note on Optimality Conditions for the Euclidean Multifacility Location Problem}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {72--80} } @Article{ deasy:multiple, author = {J. O. Deasy}, title = {Multiple local minima in radiotherapy optimization problems with dose volume constraints}, journal = {Medical Physics}, year = {1997}, optvolume = {24}, optnumber = {7}, optpages = {1157-1161} } @Article{ deboor.ron:computational, author = {C. {deBoor} and A. Ron}, title = {Computational Aspects of Polynomial Interpolation in Several Variables}, journal = {Mathematics of Computation}, year = {1992}, volume = {58}, pages = {705--727} } @Article{ debremaecker.ferris.ea:compressional, author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity Problems}, year = {2000}, key = {82}, journal = {Engineering Fracture Mechanics}, volume = {66}, pages = {287--303} } @Article{ debremaecker.ferris:comparison, author = {J.--C. {De~Bremaecker} and M. C. Ferris}, title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, year = {2000}, key = {90}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, journal = {Engineering Fracture Mechanics}, volume = {66}, pages = {601--605}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {00-01} } @Article{ dedonato.maier:mathematical, author = {O. {De~Donato} and G. Maier}, title = {Mathematical programming methods for the inelastic analysis of reinforced concrete frames allowing for limited rotation capacity}, journal = {International Journal for Numerical Methods in Engineering}, volume = {4}, year = {1972}, pages = {307--329} } @Book{ deimling:nonlinear, author = {K. Deimling}, title = {Nonlinear Functional Analysis}, publisher = {Springer-Verlag}, year = {1985} } @PhDThesis{ dejong:analysis, author = {K. A. De~Jong}, title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, year = {1975}, school = {University of Michigan}, note = {Dissertation Abstracts International 36(10), 5140B} } @Article{ deleone.mangasarian.ea:multi-sweep, author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric Linear Complementarity Problem}, journal = {Annals of Operations Research}, year = {1990}, volume = {22}, pages = {43--54} } @InCollection{ deleone.mangasarian:serial, author = {R. {De~Leone} and O. L. Mangasarian}, title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented {L}agrangian Successive Overrelaxation}, booktitle = {Optimization, Parallel Processing and Applications}, publisher = {Springer-Verlag}, year = {1988}, editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, volume = {304}, series = {Lecture Notes in Economics and Mathematical Systems}, pages = {103--124}, address = {Berlin} } @TechReport{ deluca.facchinei.ea:combining, author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear Complementarity Problems: Theory and Numerical Results}, type = {Preprint}, institution = {Institute of Applied Mathematics, University of Hamburg}, year = {1996} } @TechReport{ deluca.facchinei.ea:general, author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and Numerical Results}, type = {Preprint}, institution = {Institute of Applied Mathematics, University of Hamburg}, year = {1997} } @Article{ deluca.facchinei.ea:semismooth, author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity Problems}, journal = {Mathematical Programming}, volume = {75}, pages = {407--439}, year = {1996} } @Article{ deluca.facchinei.ea:theoretical, author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for Complementarity Problems}, year = {1999}, journal = {Computational Optimization and Applications, forthcoming} } @Article{ demarzo.eaves:computing, author = {P. M. DeMarzo and B. C. Eaves}, title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, journal = {Journal of Mathematical Economics}, year = {1996}, volume = {26}, pages = {479--497} } @Article{ dembo.steihaug:truncated, author = {R. S. Dembo and T. Steihaug}, title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained Optimization}, journal = {Mathematical Programming}, year = {1983}, volume = {26}, pages = {190--212} } @Article{ dembo:performance, author = {R. S. Dembo}, title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, journal = {Mathematical Programming Study}, year = {1986}, volume = {26}, pages = {245--248} } @Article{ demoor.vandenberghe.ea:generalized, author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, title = {The generalized linear complementarity problem and an algorithm to find all its solutions}, journal = {Mathematical Programming}, volume = {57}, year = {1992}, pages = {415--426} } @Book{ demyanov.vasilev:nondifferentiable, author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, title = {Nondifferentiable Optimization}, publisher = {Optimization Software, Inc.}, year = {1985}, address = {New York} } @Article{ dennis.torczon:direct, author = {J. E. Dennis and V. Torczon}, title = {Direct Search Methods on Parallel Machines}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {448--474} } @TechReport{ depierro.iusem:convergence, author = {A. R. {De~Pierro} and A. N. Iusem}, title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite Linear Complementarity Problems}, institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, year = {1990}, address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} } @Article{ depierro.iusem:relaxed, author = {A. R. {De~Pierro} and A. N. Iusem}, title = {A Relaxed Version of {B}regman's Method for Convex Programming}, journal = {Journal of Optimization Theory and Applications}, year = {1986}, volume = {51}, pages = {421--440} } @Book{ dervis.melo.ea:general, author = {K. Dervis and J. de Melo and S. Robinson}, title = {General Equilibrium Models of Development Policy}, publisher = {Cambridge University Press}, year = {1982}, address = {Cambridge, England} } @Article{ deschutter.demoor:minimal, author = {B. {De~Schutter} and B. {De~Moor}}, title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity Problem}, journal = {Systems \& Control Letters}, year = {1995}, pages = {103--111} } @Article{ desilets.golden.ea:predicting, author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, journal = {Computers \& Operations Research}, year = {1992}, volume = {19}, pages = {277--285} } @PhDThesis{ desilva:sensitivity, author = {A. H. DeSilva}, title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil Production}, school = {George Washington University}, address = {Washington, D.C.}, year = {1978} } @TechReport{ dijkstra:cooperating, author = {E. W. Dijkstra}, title = {Cooperating Sequential Processes}, institution = {Technological University}, year = {1965}, address = {Eindhoven, The Netherlands}, number = {EWD--123}, type = {Technical Report} } @Article{ dikin:iterative, author = {I. I. Dikin}, title = {Iterative Solution of Problems of Linear and Quadratic Programming}, journal = {Soviet Mathematics Doklady}, year = {1967}, volume = {8}, pages = {674--675} } @InCollection{ dipillo.grippo.ea:class, author = {G. Di~Pillo and L. Grippo and F. Lampariello}, title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, booktitle = {System Modelling and Optimization}, year = {1981}, editor = {R. F. Drenick and F. Kozin}, publisher = {Springer-Verlag}, address = {Berlin} } @Article{ dipillo.grippo:augmented, author = {G. Di~Pillo and L. Grippo}, title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming Problems}, journal = {Journal of Optimization Theory and Applications}, year = {1982}, volume = {36}, pages = {495--519} } @Article{ dipillo.grippo:class, author = {G. Di~Pillo and L. Grippo}, title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, journal = {SIAM Journal on Control and Optimization}, year = {1979}, volume = {17}, pages = {618--628} } @Article{ dipillo.grippo:continuously, author = {G. Di~Pillo and L. Grippo}, title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming Problems with Inequality Constraints}, journal = {SIAM Journal on Control and Optimization}, year = {1985}, volume = {23}, pages = {72--84} } @Article{ dipillo.grippo:exact, author = {G. Di~Pillo and L. Grippo}, title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear Programming Problems}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {1--18} } @TechReport{ dirkse.ferris.ea:gams, author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1994}, address = {Madison, Wisconsin}, number = {94-07}, type = {Mathematical Programming Technical Report}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, key = {25} } @InProceedings{ dirkse.ferris:crash, crossref = {ferris.pang:complementarity}, author = {S. P. Dirkse and M. C. Ferris}, title = {Crash Techniques for Large-Scale Complementarity Problems}, pages = {40--61}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, key = {52} } @Article{ dirkse.ferris:mcplib, author = {S. P. Dirkse and M. C. Ferris}, title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, journal = {Optimization Methods and Software}, pages = {319--345}, volume = {5}, year = {1995}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, key = {36} } @InCollection{ dirkse.ferris:modeling, author = {S. P. Dirkse and M. C. Ferris}, title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, year = {1999}, pages = {127--148}, editor = {M. Fukushima and L. Qi}, booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, publisher = {Kluwer Academic Publishers}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, key = {62} } @Article{ dirkse.ferris:path, author = {S. P. Dirkse and M. C. Ferris}, title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed Complementarity Problems}, journal = {Optimization Methods and Software}, pages = {123--156}, volume = {5}, year = {1995}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, key = {33} } @Article{ dirkse.ferris:pathsearch, author = {S. P. Dirkse and M. C. Ferris}, title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, journal = {Annals of Operations Research}, vol = {68}, year = {1996}, pages = {211--232}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, key = {39} } @InCollection{ dirkse.ferris:traffic, author = {S. P. Dirkse and M. C. Ferris}, title = {Traffic Modeling and Variational Inequalities using {GAMS}}, booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation Management}, publisher = {Springer-Verlag}, year = {1998}, editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, series = {NATO ASI Series F}, volume = {166}, pages = {136--163}, key = {61}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} } @PhDThesis{ dirkse:robust, author = {S. P. Dirkse}, title = {Robust Solution of Mixed Complementarity Problems}, school = {Computer Sciences Department, University of Wisconsin}, year = {1994}, address = {Madison, Wisconsin}, note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, annote = {Mathematical Programming Technical Report 94-12} } @TechReport{ dixon.mills:neural, author = {L. C. Dixon and D. J. Mills}, title = {Neural Nets for Massively Parallel Optimisation}, institution = {Hatfield Polytechnic}, year = {1992}, address = {Hatfield, Hertforshire, England}, number = {Numerical Optimisation Centre Technical Report No. 259} } @Article{ dontchev:local, author = {A. L. Dontchev}, title = {Local Convergence of the {N}ewton method for Generalized Equations}, journal = {C.R. Acad. Sci. Paris Series I}, year = {1996}, volume = {332}, pages = {327--331} } @Article{ douglas.rachford:numerical, author = {J. Douglas and H. H. Rachford}, title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space Variables}, journal = {Transactions of the American Mathematical Society}, year = {1956}, volume = {82}, pages = {421--439} } @Article{ drud:conopt, author = {A. Drud}, title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization Problems}, journal = {Mathematical Programming}, year = {1985}, volume = {31}, pages = {153--191} } @Article{ dsouza.meyer.ea:mixed, author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment Optimization}, journal = {Medical Physics}, year = {1999}, key = {85}, volume = {26}, number = {6}, pages = {1099} } @TechReport{ dsouza.meyer.ea:mixed*1, author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment Optimization}, year = {1999}, key = {87}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {99-08}, type = {Mathematical Programming Technical Report}, annote = {Submitted to } } @Article{ dsouza.meyer.ea:iterative, author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate Brachytherapy Treatment Optimization}, year = {2000}, key = {96}, journal = {Physics and Medicine in Biology, forthcoming} } @Article{ du.yu.ea:multileaf, author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and G. Gustafson and A. Martinez and J. W. Wong}, title = {A multileaf collimator field prescription preparation system for conventional radiotherapy}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1994}, volume = {30}, number = {3}, pages = {707--714} } @Article{ duda.fossum:pattern, author = {R. O. Duda and H. Fossum}, title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear Discriminant Functions}, journal = {IEEE Transactions on Electronic Computers}, year = {1966}, volume = {15}, pages = {220--232} } @Book{ duda.hart:pattern, author = {R. O. Duda and P. E. Hart}, title = {Pattern Classification and Scene Analysis}, year = {1973}, publisher = {John Wiley \& Sons}, address = {New York} } @Book{ duff.erisman.ea:direct, author = {I. S. Duff and A. M. Erisman and J. K. Reid}, title = {Direct Methods for Sparse Matrices}, publisher = {Oxford University Press}, year = {1986}, address = {Oxford, England} } @InCollection{ duffin:infinite, author = {R. J. Duffin}, title = {Infinite Programs}, booktitle = {Linear Inequalities and Related Systems}, year = {1975}, editor = {H. W. Kuhn and A. W. Tucker}, publisher = {Princeton University Press}, address = {Princeton, New Jersey}, pages = {157--170} } @Article{ dunn.sachs:effect, author = {J. C. Dunn and E. Sachs}, title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, journal = {Applied Mathematics and Optimization}, year = {1983}, volume = {10}, pages = {143--157} } @Article{ dunn:convergence, author = {J. C. Dunn}, title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, journal = {Journal of Optimization Theory and Applications}, year = {1987}, volume = {55}, pages = {203--216} } @Article{ dunn:global, author = {J. C. Dunn}, title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected Gradient Processes}, journal = {SIAM Journal on Control and Optimization}, year = {1981}, volume = {19}, pages = {368--400} } @Article{ dunn:rates, author = {J. C. Dunn}, title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and Nonsingular Extremals}, journal = {SIAM Journal on Control and Optimization}, year = {1979}, volume = {17}, pages = {187--211} } @Article{ dupuis.simha:sampling, author = {P. Dupuis and R. Simha}, title = {On Sampling-Controlled Stochastic Approximation}, journal = {{IEEE} Transactions on Automatic Control}, year = {1991}, volume = {36}, pages = {915--924} } @TechReport{ eager.ferris.ea:models, author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1999}, type = {Technical Report}, number = {1402}, address = {Madison, Wisconsin}, url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, key = {84} } @InProceedings{ eager.ferris.ea:optimized, author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, title = {Optimized Regional Caching for On-Demand Data Delivery}, year = {1999}, booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, volume = {3654}, address = {Bellingham, Washington}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, key = {69}, pages = {301--316}, annote = {18 percent acceptance rate} } @Article{ eager.ferris.ea:optimized*1, author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, title = {Optimized Caching in Systems with Heterogeneous Client Populations}, journal = {Performance Evaluation}, year = {2000}, key = {72}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, volume = {42}, pages = {163--185} } @InProceedings{ eager.vernon:dynamic, author = {D. L. Eager and M. K. Vernon}, title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, year = {1998}, booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems ({MIS '98})}, pages = {18--32}, address = {Istanbul, Turkey} } @Article{ eaves.lemke:equivalence, author = {B. C. Eaves and C. E. Lemke}, title = {Equivalence of {LCP} and {PLS}}, journal = {Mathematics of Operations Research}, year = {1981}, volume = {6}, pages = {475--484} } @Article{ eaves.rothblum:relationships, author = {B. C. Eaves and U. G. Rothblum}, title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, journal = {Linear Algebra and Its Applications}, year = {1990}, volume = {132}, pages = {1--63} } @Article{ eaves:basic, author = {B. C. Eaves}, title = {On the Basic Theorem of Complementarity}, journal = {Mathematical Programming}, year = {1971}, volume = {1}, pages = {68--87} } @Article{ eaves:computing, author = {B. C. Eaves}, title = {Computing Stationary Points}, journal = {Mathematical Programming Study}, year = {1978}, volume = {7}, pages = {1--14} } @InCollection{ eaves:computing*1, author = {B. C. Eaves}, title = {Computing Stationary Points, Again}, pages = {391--405}, crossref = {mangasarian.meyer.ea:nonlinear*3} } @Article{ eaves:homotopies, author = {B. C. Eaves}, title = {Homotopies for Computation of Fixed Points}, journal = {Mathematical Programming}, year = {1972}, volume = {3}, pages = {1--22} } @Article{ eaves:linear, author = {B. C. Eaves}, title = {The Linear Complementarity Problem}, journal = {Management Science}, year = {1971}, volume = {17}, pages = {612--634} } @Article{ eaves:quadratic, author = {B. C. Eaves}, title = {On Quadratic Programming}, journal = {Management Science}, year = {1971}, volume = {17}, pages = {698--711} } @InProceedings{ eaves:short, author = {B. C. Eaves}, title = {A Short Course in Solving Equations with {PL} Homotopies}, booktitle = {Nonlinear Programming}, organization = {American Mathematical Society}, year = {1976}, editor = {R. W. Cottle and C. E. Lemke}, publisher = {SIAM--AMS Proceedings}, address = {Providence, RI}, pages = {73--143} } @InCollection{ ebiefung.kostreva:global, author = {A. A. Ebiefung and M. M. Kostreva}, title = {Global Solvability of Generalized Linear Complementarity Problems and a Related Class of Polynomial Complementarity Problems}, editors = {C. Floudas and P. Pardalos}, booktitle = {Recent Advances in Global Optimization}, publisher = {Princeton University Press}, pages = {102--124}, year = {1991} } @TechReport{ ebiefung.kostreva:z-matrices, author = {A. A. Ebiefung and M. M. Kostreva}, title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, institution = {Department of Mathematical Sciences, Clemson University}, year = {1991}, number = {608}, address = {Clemson, South Carolina} } @TechReport{ eckstein.bertsekas:alternating, author = {J. Eckstein and D. P. Bertsekas}, title = {An Alternating Direction Method for Linear Programming}, institution = {Harvard Business School}, year = {1990}, type = {Working Paper}, number = {90-063}, address = {Boston, MA} } @Article{ eckstein.bertsekas:douglas-rachford, author = {J. Eckstein and D. P. Bertsekas}, title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for Maximal Monotone Operators}, journal = {Mathematical Programming}, year = {1992}, pages = {293--318}, volume = {55} } @Article{ eckstein.bertsekas:douglas-rachford*1, author = {J. Eckstein and D. P. Bertsekas}, title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm for Maximal Monotone Operators}, journal = {Mathematical Programming}, year = {1991}, note = {To appear} } @TechReport{ eckstein.ferris:operator, author = {J. Eckstein and M. C. Ferris}, title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, institution = {Thinking Machines Corporation}, year = {1992}, address = {Cambridge, MA 02142}, number = {239}, type = {TMC}, key = {26} } @Article{ eckstein.ferris:operator*1, author = {J. Eckstein and M. C. Ferris}, title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a Parallel Application to Optimal Control}, volume = {10}, pages = {218--235}, year = {1998}, journal = {INFORMS Journal on Computing}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, key = {44} } @Article{ eckstein.ferris:smooth, author = {J. Eckstein and M. C. Ferris}, title = {Smooth Methods of Multipliers for Complementarity Problems}, key = {58}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, year = {1999}, journal = {Mathematical Programming}, volume = {86}, pages = {65--90} } @InProceedings{ eckstein.hart.ea:resource, author = {J. Eckstein and W. E. Hart and C. A. Phillips}, title = {Resource Management in a Parallel Mixed Integer Programming Package}, booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, year = {1997}, note = {www.cs.sandia.gov/ISUG97} } @Article{ eckstein:alternating, author = {J. Eckstein}, title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine CM-2}}, journal = {ORSA Journal on Computing}, year = {to appear} } @Article{ eckstein:approximate, author = {J. Eckstein}, title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, year = {1998}, journal = {Mathematical Programming}, volume = {83}, pages = {113--124} } @Article{ eckstein:communication, author = {J. Eckstein}, title = {How Much Communication Does Parallel Branch and Bound Need}, journal = {{INFORMS} Journal on Computing}, volume = {9}, year = {1997}, pages = {15--29} } @Article{ eckstein:distributed, author = {J. Eckstein}, title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed Integer Programming on the {CM}-5}, journal = {Computational Optimization and Applications}, volume = {7}, pages = {199--220}, year = {1997} } @TechReport{ eckstein:lions-mercier, author = {J. Eckstein}, title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method as instances of the Proximal Point Algorithm}, institution = {MIT}, year = {1988}, address = {Cambridge, Massachusetts}, number = {LIDS-P-1769} } @Article{ eckstein:nonlinear, author = {J. Eckstein}, title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications to Convex Programming}, journal = {Mathematics of Operations Research}, year = {1993}, pages = {202--226}, volume = {18} } @Article{ eckstein:parallel, author = {J. Eckstein}, title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the {CM}-5}, journal = {SIAM Journal on Optimization}, volume = {4}, pages = {794--814}, year = {1994} } @TechReport{ eckstein:smooth, author = {J. Eckstein}, title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, institution = {Rutgers Center for Operations Research, Rutgers University}, address = {New Brunswick, New Jersey}, year = {1996}, type = {Research Report}, number = {27-96} } @PhDThesis{ eckstein:splitting, author = {J. Eckstein}, title = {Splitting Methods for Monotone Operators, with Applications to Parallel Optimization}, school = {Massachusetts Institute of Technology}, year = {1989}, address = {Cambridge, MA}, note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} } @Article{ eglese:simulated, author = {R. W. Eglese}, title = {Simulated Annealing: {A} Tool for Operational Research}, journal = {European Journal of Operations Research}, year = {1990}, volume = {46}, pages = {271--281} } @Book{ ekeland.temam:convex, author = {I. Ekeland and R. Temam}, title = {Convex Analysis and Variational Problems}, year = {1976}, publisher = {North--Holland}, address = {Amsterdam} } @Article{ ekeland:variational, author = {I. Ekeland}, title = {On the Variational Principle}, journal = {Journal of Mathematical Analysis and Applications}, year = {1974}, volume = {47}, pages = {324--353} } @TechReport{ el-bakry.tapia.ea:formulation, author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, title = {On the formulation and theory of the primal-dual {N}ewton interior-point method for nonlinear programming}, type = {{Technical Report TR92-40}}, institution = {{Department of Computational and Applied Mathematics, Rice University}}, year = {1992} } @Article{ eldersveld.saunders:block, author = {S. K. Eldersveld and M. A. Saunders}, title = {A Block-{LU} Update for Large--Scale Linear Programming}, journal = {SIAM Journal on Matrix Analysis and Applications}, year = {1992}, volume = {13}, pages = {191--201} } @Article{ elster.neumaier:grid, author = {C. Elster and A. Neumaier}, title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, journal = {{IMA} Journal of Numerical Analysis}, year = {1995}, volume = {15}, pages = {585--608} } @Article{ epema.livny.ea:worldwide, author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, journal = {Journal on Future Generations of Computer Systems}, year = {1996}, volume = {12}, pages = {53--65} } @Book{ ermoliev.editors:numerical, author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, title = {Numerical Techniques for Stochastic Optimization Problems}, year = {1988}, publisher = {Springer-Verlag}, address = {Berlin} } @TechReport{ evett.spiehler:rule, author = {I. W. Evett and E. J. Spiehler}, title = {Rule Induction in Forensic Science}, institution = {Central Research Establishment, Home Office Forensic Science Service}, year = {1987}, address = {Aldermaston, Reading, Berkshire RG7 4PN}, type = {Technical Report} } @Article{ evtushenko.purtov:sufficient, author = {Y. G. Evtushenko and V. A. Purtov}, title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, journal = {Soviet Mathematics Doklady}, year = {1984}, volume = {30}, pages = {313--316} } @Article{ facchinei.fischer.ea:regularity, author = {F. Facchinei and A. Fischer and C. Kanzow}, title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, journal = {SIAM Journal on Optimization}, year = {1998}, volume = {8}, pages = {850--869} } @Article{ facchinei.fischer.ea:semismooth, title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box Constraints}, author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, journal = {Complementarity and Variational Problems: State of the Art}, volume = {92}, pages = {76}, year = {1997} } @TechReport{ facchinei.fischer.ea:simply, author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from Variational Inequalities}, institution = {University of Hamburg}, year = {1996} } @Article{ facchinei.jiang.ea:smoothing, author = {F. Facchinei and H. Jiang and L. Qi}, title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, year = {1999}, journal = {Mathematical Programming}, volume = {85}, pages = {107--134} } @Article{ facchinei.kanzow:nonsmooth, author = {F. Facchinei and C. Kanzow}, title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear Complementarity Problems}, year = {1997}, journal = {Mathematical Programming}, volume = {76}, pages = {493--512} } @Article{ facchinei.kanzow:unconstrained, author = {F. Facchinei and C. Kanzow}, title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit {L}agrangian}, year = {1997}, journal = {Journal of Optimization Theory and Applications}, volume = {92}, pages = {99--115} } @TechReport{ facchinei.pang:total, author = {F. Facchinei and J. S. Pang}, title = {Total stability of variational inequalities}, institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, year = {1988}, type = {Manuscript}, address = {Roma, Italy} } @Article{ facchinei.soares:merit, author = {F. Facchinei and J. Soares}, title = {A New Merit Function for Nonlinear Complementarity Problems and a Related Algorithm}, journal = {SIAM Journal on Optimization}, year = {1997}, volume = {7}, pages = {225--247} } @InCollection{ facchinei.soares:testing, author = {F. Facchinei and J. Soares}, title = {Testing a new class of algorithms for nonlinear complementarity problems}, booktitle = {Variational Inequalities and Network Equilibrium Problems}, publisher = {Plenum Press}, address = {New York}, editor = {F. Giannessi and A. Maugeri}, year = {1995}, pages = {69--83} } @InProceedings{ fahlman.lebiere:cascade-correlation, author = {S. E. Fahlman and C. Lebiere}, title = {The cascade-correlation learning architecture}, booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, year = {1990}, editor = {D. S. Touretzky}, publisher = {Morgan Kaufmann}, address = {San Mateo, California}, pages = {524--532} } @InProceedings{ fang.geiser.ea:software, author = {G. Fang and B. Geiser and T. R. Mackie}, title = {Software system for {UW}/{GE} tomotherapy prototype}, booktitle = {Proceedings of the XII International Conference on the Use of Computers in Radiation Therapy, Salt Lake City}, year = {1997}, editor = {D. D. Leavitt and G. Starkshall}, publisher = {Medical Physics Publishing}, address = {St. Louis, Missouri}, pages = {332--334} } @Book{ fang.puthenpura:linear, author = {S.--C. Fang and S. Puthenpura}, title = {Linear Optimization and Extensions}, year = {1993}, publisher = {Prentice-Hall, Inc}, address = {Englewood Cliffs, New Jersey} } @Article{ fayard.plateau:algorithm, author = {D. Fayard and G. Plateau}, title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, journal = {Computing}, year = {1982}, volume = {28}, pages = {269--287} } @Book{ feller:introduction, author = {W. Feller}, title = {An Introduction to Probability Theory and its Applications}, publisher = {John Wiley \& Sons}, year = {1968}, address = {New York} } @Article{ ferris.fourer.ea:expressing, author = {M. C. Ferris and R. Fourer and D. M. Gay}, title = {Expressing Complementarity Problems and Communicating them to Solvers}, journal = {SIAM Journal on Optimization}, volume = {9}, pages = {991--1009}, year = {1999}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, key = {65}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-02}, type = {Mathematical Programming Technical Report} } @TechReport{ ferris.horn:nlp2mcp, author = {M. C. Ferris and J. D. Horn}, title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity problems}, year = {1998}, institution = {Computer Sciences Department, University of Wisconsin}, note = {In preparation} } @Article{ ferris.horn:partitioning, author = {M. C. Ferris and J. D. Horn}, title = {Partitioning Mathematical Programs for Parallel Solution}, year = {1998}, volume = {80}, pages = {35--62}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, journal = {Mathematical Programming}, key = {40} } @Article{ ferris.kanzow.ea:feasible, author = {M. C. Ferris and C. Kanzow and T. S. Munson}, title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, year = {1999}, journal = {Mathematical Programming}, volume = {86}, pages = {475--497}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, key = {67} } @InCollection{ ferris.kanzow:complementarity, author = {M. C. Ferris and C. Kanzow}, title = {Complementarity and Related Problems: {A} Survey}, booktitle = {Handbook of Applied Optimization, forthcoming}, key = {74}, publisher = {Oxford University Press}, year = {2000}, editor = {P. M. Pardalos and M. G. C. Resende}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-17}, type = {Mathematical Programming Technical Report} } @Article{ ferris.lucidi.ea:nonmonotone, author = {M. C. Ferris and S. Lucidi and M. Roma}, title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, journal = {Computational Optimization and Applications}, volume = {6}, pages = {117--136}, year = {1996}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, key = {43} } @TechReport{ ferris.lucidi:globally, author = {M. C. Ferris and S. Lucidi}, title = {Globally Convergent Methods for Nonlinear Equations}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1991}, address = {Madison, Wisconsin}, number = {1030}, url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, key = {21} } @Article{ ferris.lucidi:nonmonotone, author = {M. C. Ferris and S. Lucidi}, title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, journal = {Journal of Optimization Theory and Applications}, year = {1994}, volume = {81}, pages = {53--71}, key = {30} } @Article{ ferris.mangasarian:breast, author = {M. C. Ferris and O. L. Mangasarian}, title = {Breast Cancer Diagnosis via Linear Programming}, key = {50}, journal = {{IEEE} Computational Science and Engineering}, year = {1995}, volume = {2}, pages = {70--71} } @Article{ ferris.mangasarian:error, author = {M. C. Ferris and O. L. Mangasarian}, title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational Inequalities}, journal = {Annals of Operations Research}, year = {1993}, volume = {47}, pages = {293--305}, url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, key = {24} } @Article{ ferris.mangasarian:finite, author = {M. C. Ferris and O. L. Mangasarian}, title = {Finite Perturbation of Convex Programs}, journal = {Applied Mathematics and Optimization}, year = {1991}, volume = {23}, pages = {263--273}, key = {08} } @Book{ ferris.mangasarian:linear, author = {M. C. Ferris and O. L. Mangasarian}, title = {Linear Programming via {MATLAB}}, publisher = {in preparation}, year = {1995}, address = {Madison, Wisconsin} } @Article{ ferris.mangasarian:minimum, author = {M. C. Ferris and O. L. Mangasarian}, title = {Minimum Principle Sufficiency}, journal = {Mathematical Programming}, year = {1992}, volume = {57}, pages = {1--14}, key = {11} } @Article{ ferris.mangasarian:parallel, author = {M. C. Ferris and O. L. Mangasarian}, title = {Parallel Constraint Distribution}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {487--500}, url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, key = {18} } @Article{ ferris.mangasarian:parallel*1, author = {M. C. Ferris and O. L. Mangasarian}, title = {Parallel Variable Distribution}, journal = {SIAM Journal on Optimization}, year = {1994}, volume = {4}, pages = {815--832}, url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, key = {31} } @Article{ ferris.meeraus.ea:computing, title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, journal = {Optimization Methods and Software}, year = {1999}, volume = {10}, pages = {669--685}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, key = {45} } @Article{ ferris.mesnier.ea:neos, author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the {I}nternet}, year = {2000}, journal = {{ACM} Transactions on Mathematical Software}, key = {54}, volume = {26}, pages = {1--18}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {96-08}, type = {Mathematical Programming Technical Report}, note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, Argonne National Laboratory}, annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 1996} } @InCollection{ ferris.meyer:models, author = {M. C. Ferris and R. R. Meyer}, title = {Models and Solution for On-Demand Data Delivery Problems}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, key = {80}, booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete Problems}, editor = {P. M. Pardalos}, series = {Nonconvex Optimization and its Applications}, volume = {42}, address = {Dordrect}, year = {2000}, pages = {175--188}, publisher = {Kluwer}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, number = {99-04} } @InProceedings{ ferris.munson.ea:homotopy, author = {M. C. Ferris and T. S. Munson and D. Ralph}, title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, booktitle = {Numerical Analysis 1999}, key = {88}, year = {2000}, editor = {D. F. Griffiths and G. A. Watson}, series = {Research Notes in Mathematics}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, address = {London}, pages = {143--167}, publisher = {Chapman and Hall}, institution = {Computer Sciences Department, University of Wisconsin}, number = {99-09}, type = {Mathematical Programming Technical Report} } @TechReport{ ferris.munson.ea:practical, author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, title = {A Practical Approach to Sample-Path Simulation Optimization}, type = {Data Mining Institute Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, year = {2000}, url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, number = {00-03}, key = {92}, annote = {To appear in WSC 2000} } @InCollection{ ferris.munson:case, author = {M. C. Ferris and T. S. Munson}, title = {Case Studies in Complementarity: Improving Model Formulation}, booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, key = {73}, pages = {79--98}, publisher = {Springer Verlag}, year = {1999}, editor = {M. Th\'{e}ra and R. Tichatschke}, number = {477}, series = {Lecture Notes in Economics and Mathematical Systems}, address = {Berlin}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin} } @Article{ ferris.munson:complementarity, author = {M. C. Ferris and T. S. Munson}, title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, year = {2000}, volume = {24}, pages = {165--188}, journal = {Journal of Economic Dynamics and Control}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, key = {70}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-12} } @Misc{ ferris.munson:condor, author = {M. C. Ferris and T. S. Munson}, title = {Condor Modeling Language Interface}, organization = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, note = {ftp://ftp.cs.wisc.edu/math-prog/condor} } @Manual{ ferris.munson:gams, author = {M. C. Ferris and T. S. Munson}, title = {{GAMS}/{PATH} User Guide: Version 4.3}, organization = {Department of Computer Sciences, University of Wisconsin, Madison} } @Article{ ferris.munson:interfaces, author = {M. C. Ferris and T. S. Munson}, title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, journal = {Computational Optimization and Applications}, volume = {12}, pages = {207--227}, year = {1999}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, key = {63}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {97-12}, type = {Mathematical Programming Technical Report} } @TechReport{ ferris.munson:interior, author = {M. C. Ferris and T. S. Munson}, title = {Interior Point Methods for Massive Support Vector Machines}, institution = {Computer Sciences Department, University of Wisconsin}, year = {2000}, key = {94}, type = {Data Mining Institute Technical Report}, number = {00-05}, url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, address = {Madison, Wisconsin}, annote = {Submitted to SIOPT} } @Article{ ferris.munson:linear, author = {M. C. Ferris and T. S. Munson}, title = {Linear Programming for Emergency Broadcast Systems}, year = {1999}, journal = {{SIAG/OPT} Newsletter}, volume = {10}, pages = {6--8}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, key = {76}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-20} } @Article{ ferris.munson:modeling, author = {M. C. Ferris and T. S. Munson}, title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, year = {2000}, journal = {Mathematical Programming}, volume = {88}, pages = {487--506}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, key = {71}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-13} } @TechReport{ ferris.munson:preprocessing, author = {M. C. Ferris and T. S. Munson}, title = {Preprocessing Complementarity Problems}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, year = {1999}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, number = {99-07}, key = {86}, annote = {Submitted to ICCP 99} } @TechReport{ ferris.munson:semismooth, author = {M. C. Ferris and T. S. Munson}, title = {Semismooth Support Vector Machines}, institution = {Computer Sciences Department, University of Wisconsin}, year = {2000}, key = {97}, type = {Data Mining Institute Technical Report}, number = {00-09}, url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, address = {Madison, Wisconsin}, annote = {Submitted to Math Prog B} } @Article{ ferris.pang:engineering, author = {M. C. Ferris and J. S. Pang}, title = {Engineering and Economic Applications of Complementarity Problems}, year = {1997}, journal = {SIAM Review}, volume = {39}, pages = {669--713}, url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, key = {46} } @Article{ ferris.pang:nondegenerate, author = {M. C. Ferris and J. S. Pang}, title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, journal = {SIAM Journal on Control and Optimization}, year = {1996}, volume = {34}, pages = {244--263}, url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, key = {35} } @Article{ ferris.philpott:affine, author = {M. C. Ferris and A. B. Philpott}, title = {On Affine Scaling and Semi--Infinite Programming}, journal = {Mathematical Programming}, year = {1992}, volume = {56}, pages = {361--364}, key = {15} } @Article{ ferris.philpott:interior, author = {M. C. Ferris and A. B. Philpott}, title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, journal = {Mathematical Programming}, year = {1989}, volume = {43}, pages = {257--276}, key = {04} } @Article{ ferris.philpott:performance, author = {M. C. Ferris and A. B. Philpott}, title = {On the Performance of {K}armarkar's Algorithm}, journal = {Journal of the Operational Research Society}, year = {1988}, volume = {39}, pages = {257--270}, key = {03} } @InCollection{ ferris.ralph:projected, author = {M. C. Ferris and D. Ralph}, title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal Maps}, booktitle = {Recent Advances in Nonsmooth Optimization}, publisher = {World Scientific Publishers}, year = {1995}, pages = {57--87}, editor = {D. Du and L. Qi and R. Womersley}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, key = {41} } @Article{ ferris.ruszczynski:robust, author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, year = {2000}, journal = {Networks}, volume = {35}, pages = {181--194}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, key = {60} } @InCollection{ ferris.rutherford:accessing, author = {M. C. Ferris and T. F. Rutherford}, title = {Accessing Realistic Complementarity Problems within {Matlab}}, booktitle = {Nonlinear Optimization and Applications}, key = {48}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, editor = {G. Di Pillo and F. Giannessi}, year = {1996}, pages = {141--153}, publisher = {Plenum Press}, address = {New York} } @InCollection{ ferris.shepard:optimizing, author = {M. C. Ferris and D. M. Shepard}, title = {Optimization of Gamma Knife Radiosurgery}, booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, editor = {D.-Z. Du and P. Pardolas and J. Wang}, publisher = {AMS}, year = {2000}, optseries = {DIMACS}, url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, key = {91}, type = {Data Mining Institute Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {00-01} } @InCollection{ ferris.sinapiromsaran:formulating, author = {M. C. Ferris and K. Sinapiromsaran}, title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, booktitle = {Optimization}, key = {77}, publisher = {Springer-Verlag}, year = {2000}, editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, volume = {481}, series = {Lecture Notes in Economics and Mathematical Systems}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-21} } @Article{ ferris.tin-loi:limit, author = {M. C. Ferris and F. Tin-Loi}, title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with Complementarity Constraints}, year = {2001}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, key = {78}, journal = {International Journal of Mechanical Sciences}, pages = {209--224}, volume = {43}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {99-01} } @Article{ ferris.tin-loi:nonlinear, author = {M. C. Ferris and F. Tin-Loi}, title = {Nonlinear Programming Approach for a Class of Inverse Problems in Elastoplasticity}, year = {1998}, key = {64}, volume = {6}, pages = {857--870}, journal = {Structural Engineering and Mechanics} } @Article{ ferris.tin-loi:solution, author = {M. C. Ferris and F. Tin-Loi}, title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement and Complementarity Constraints}, year = {1999}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {174}, pages = {107--120}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, key = {66} } @Article{ ferris.vlach:scheduling, author = {M. C. Ferris and M. Vlach}, title = {Scheduling with Earliness and Tardiness Penalties}, journal = {Naval Research Logistics Quarterly}, year = {1992}, volume = {39}, pages = {229--245}, key = {13} } @TechReport{ ferris.zavriev:linear, author = {M. C. Ferris and S. K Zavriev}, title = {The Linear Convergence of a Successive Linear Programming Algorithm}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1996}, key = {56}, address = {Madison, Wisconsin}, type = {Mathematical Programming Technical Report}, number = {96--12}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} } @Article{ ferris:finite, author = {M. C. Ferris}, title = {Finite Termination of the Proximal Point Algorithm}, journal = {Mathematical Programming}, year = {1991}, volume = {50}, pages = {359--366}, key = {06} } @Article{ ferris:iterative, author = {M. C. Ferris}, title = {Iterative Linear Programming Solution of Convex Programs}, journal = {Journal of Optimization Theory and Applications}, year = {1990}, volume = {65}, pages = {53--65}, key = {07} } @Article{ ferris:linear, author = {M. C. Ferris}, title = {The Linear Complementarity Problem}, journal = {Bulletin of the American Mathematical Society}, year = {1993}, volume = {28}, pages = {169--175}, key = {27} } @MastersThesis{ ferris:linear*1, author = {M. C. Ferris}, title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for Solving a Class of Structural Optimization Problems}, year = {1985}, school = {University of Cambridge}, address = {England}, key = {01} } @TechReport{ ferris:matlab, author = {M. C. Ferris}, title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1998}, address = {Madison, Wisconsin}, type = {Mathematical Programming Technical Report}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, number = {98-19}, key = {75} } @Article{ ferris:parallel, author = {M. C. Ferris}, title = {Parallel Constraint Distribution for Convex Quadratic Programs}, journal = {Mathematics of Operations Research}, year = {1994}, volume = {19}, pages = {645--658}, url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, key = {20} } @TechReport{ ferris:parallel*1, author = {M. C. Ferris}, title = {Parallel Solution of Extremely Large Knapsack Problems}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1989}, address = {Madison, Wisconsin}, number = {842}, key = {09} } @PhDThesis{ ferris:weak, author = {M. C. Ferris}, title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, year = {1988}, school = {University of Cambridge}, address = {England}, key = {02} } @TechReport{ ferris:weak*1, author = {M. C. Ferris}, title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1988}, address = {Madison, Wisconsin}, number = {779}, key = {05} } @Book{ fiacco.mccormick:nonlinear, author = {A. V. Fiacco and G. P. McCormick}, title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, year = {1968}, publisher = {John Wiley \& Sons}, address = {New York}, note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} } @Book{ fiacco:introduction, author = {A. V. Fiacco}, title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, year = {1983}, publisher = {Academic Press}, address = {New York} } @Article{ fiedler.ptak:matrices, author = {M. Fiedler and V. Pt\'{a}k}, title = {On matrices with nonpositive off-diagonal elements and positive principal minors}, journal = {Czechoslovak Mathematics Journal}, volume = {12}, pages = {382--400}, year = {1962} } @Article{ fischer.kanzow:finite, author = {A. Fischer and C. Kanzow}, title = {On Finite Termination of an Iterative Method for Linear Complementarity Problems}, journal = {Mathematical Programming}, volume = {74}, pages = {279--292}, year = {1996} } @TechReport{ fischer:constrained, author = {A. Fischer}, title = {A New Constrained Optimization Reformulation for Complementarity Problems}, institution = {Institute of Numerical Mathematics, Technical University of Dresden}, year = {1995}, type = {Technical Report}, number = {MATH-NM-10-1995}, address = {Dresden} } @Article{ fischer:local, author = {A. Fischer}, title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under weak conditions}, journal = {Optimization Methods and Software}, year = {1995}, volume = {6}, pages = {83--107} } @InCollection{ fischer:ncp-function, author = {A. Fischer}, title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, booktitle = {Recent Advances in Nonsmooth Optimization}, publisher = {World Scientific Publishers}, editor = {D. Z. Du and L. Qi and R. S. Womersley}, year = {1995}, pages = {88--105} } @Article{ fischer:newton-type, author = {A. Fischer}, title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity Problems}, journal = {Journal of Optimization Theory and Applications}, year = {1995}, volume = {86}, pages = {585--608} } @Article{ fischer:solution, author = {A. Fischer}, title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian Functions}, year = {1997}, journal = {Mathematical Programming}, pages = {513--532} } @Article{ fischer:special, author = {A. Fischer}, title = {A Special {N}ewton--Type Optimization Method}, journal = {Optimization}, year = {1992}, volume = {24}, pages = {269--284} } @Article{ fisher:use, author = {R. A. Fisher}, title = {The Use of Multiple Measurements in Taxonomic Problems}, journal = {Annual Eugenics}, year = {1936}, volume = {7}, number = {Part II}, pages = {179--188} } @Book{ fishman:principles, author = {G. Fishman}, title = {Principles of Discrete Event Simulation}, publisher = {Wiley}, address = {New York, NY}, year = {1978} } @Article{ fitchard.aldridge.ea:registration, author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, title = {Registration of Synthetic Tomographic Projection Data Sets Using Cross-Correlation}, journal = {Physics in Medicine and Biology}, year = {1998}, volume = {43}, pages = {1645--1657} } @Article{ fletcher.matthews:stable, author = {R. Fletcher and S. P. J. Matthews}, title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, journal = {Mathematical Programming}, year = {1984}, volume = {30}, pages = {267--284} } @TechReport{ fletcher.maza:nonlinear, author = {R. Fletcher and E. Sainz de la Maza}, title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear Programming}, institution = {Department of Mathematical Sciences}, year = {1987}, address = {The University, Dundee, Scotland}, number = {NA/100}, type = {Numerical Analysis Report} } @InCollection{ fletcher:class, author = {R. Fletcher}, title = {A Class of Methods for Nonlinear Programming with Termination and Convergence Properties}, booktitle = {Integer and Nonlinear Programming}, year = {1970}, editor = {J. Abadie}, publisher = {North--Holland}, address = {Amsterdam}, pages = {157--173} } @Article{ fletcher:exact, author = {R. Fletcher}, title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, journal = {Mathematical Programming}, year = {1973}, volume = {5}, pages = {129--150} } @Article{ fletcher:generalized, author = {R. Fletcher}, title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear Equations}, journal = {The Computer Journal}, year = {1968}, volume = {10}, pages = {392--399} } @InProceedings{ fletcher:penalty, crossref = {bachem.grotschel.ea:mathematical}, author = {R. Fletcher}, title = {Penalty Functions}, pages = {87--114} } @Book{ fletcher:practical, author = {R. Fletcher}, title = {Practical Methods of Optimization}, year = {1981}, publisher = {John Wiley \& Sons}, address = {Chichester}, volume = {1} } @Book{ fletcher:practical*1, author = {R. Fletcher}, title = {Practical Methods of Optimization}, year = {1981}, publisher = {John Wiley \& Sons}, address = {Chichester}, volume = {2} } @Book{ fletcher:practical*2, author = {R. Fletcher}, title = {Practical Methods of Optimization}, year = {1987}, publisher = {John Wiley \& Sons}, address = {New York}, edition = {second} } @Unpublished{ fletcher:recent, author = {R. Fletcher}, title = {Recent Developments in Nonlinear Programming}, note = {Presentation at SOR 96, Braunchweig, Germany}, year = {1996} } @InCollection{ fletcher:second, author = {R. Fletcher}, title = {Second Order Correction for Nondifferentiable Optimization}, booktitle = {Numerical Analysis}, year = {1982}, editor = {G. A. Watson}, publisher = {Springer-Verlag}, address = {Berlin}, pages = {85--114} } @InCollection{ florian:mathematical, author = {M. Florian}, title = {Mathematical programming applications in national, regional, and urban planning}, editors = {M. Iri and K. Tanabe}, booktitle = {Mathematical Programming: Recent Developments and Applications}, publisher = {Kluwer Academic Publishers}, address = {Tokyo}, year = {1989} } @Article{ florian:nonlinear, author = {M. Florian}, title = {Nonlinear Cost Network Models in Transportation Analysis}, journal = {Mathematical Programming Study}, year = {1986}, volume = {26}, pages = {167--196} } @Article{ flynn:computer, author = {M.~J. Flynn}, title = {Some Computer Organizations and their Effectiveness}, journal = {IEEE Transactions on Computers}, year = {1972}, volume = {C-21}, pages = {948--960} } @InProceedings{ fogarty:varying, crossref = {schaeffer:third}, author = {T. C. Fogarty}, title = {Varying the Probability of Mutation in the Genetic Algorithm}, pages = {422--427} } @Article{ forrest.goldfarb:steepest-edge, author = {J. J. Forrest and D. Goldfarb}, title = {Steepest--Edge Simplex Algorithms for Linear Programming}, journal = {Mathematical Programming}, year = {1992}, volume = {57}, pages = {341--374} } @Article{ forrest.tomlin:updating, author = {J. J. H. Forrest and J. A. Tomlin}, title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form Simplex Method}, journal = {Mathematical Programming}, year = {1972}, volume = {2}, pages = {263--278} } @TechReport{ forsgren.gill.ea:computing, author = {A. Forsgren and P. E. Gill and W. Murray}, title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, institution = {Department of Mathematics, Royal Institute of Technology}, year = {1993}, number = {TRITA-MAT-1993-9}, address = {Stockholm, Sweden} } @TechReport{ forsgren.gill:primal-dual, author = {A. Forsgren and P. E. Gill}, title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, institution = {Department of Mathematics, University of California}, year = {1996}, type = {Report NA}, number = {96-3}, address = {San Diego} } @InCollection{ fortin.glowinski:decomposition-coordination, author = {M. Fortin and R. Glowinski}, title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value Problems}, publisher = {North-Holland}, year = {1983}, editor = {M. Fortin and R. Glowinski}, address = {Amsterdam} } @Misc{ foster.kesselman:globus, author = {I. Foster and C. Kesselman}, title = {The Globus Project}, howpublished = {www.globus.org} } @Article{ foster.kesselman:globus*1, author = {I. Foster and C. Kesselman}, title = {Globus: A Metacomputing Infrastructure Toolkit}, journal = {International Journal of Supercomputer Applications}, volume = {11}, pages = {115--128}, year = {1997} } @Book{ foster.kesselman:grid, editor = {I. Foster and C. Kesselman}, title = {The Grid: Blueprint for a Future Computing Infrastructure}, publisher = {Morgan Kaufmann Publishers}, year = {1999} } @Book{ fourer.gay.ea:ampl, author = {R. Fourer and D. M. Gay and B. W. Kernighan}, title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, year = {1993}, publisher = {Duxbury Press} } @Article{ fourer.gay.ea:modeling, author = {R. Fourer and D. M. Gay and B. W. Kernighan}, title = {A Modeling Language for Mathematical Programming}, journal = {Management Science}, year = {1990}, volume = {36}, pages = {519--554} } @Article{ fraass:development, author = {A. Fraass}, title = {The development of conformal radiation therapy}, journal = {Medical Physics}, year = {1995}, volume = {22}, number = {11}, pages = {1911--1921} } @TechReport{ fraley:algorithms, author = {C. Fraley}, title = {Algorithms for Nonlinear Least Squares}, institution = {Stanford University}, year = {1988}, number = {{SOL} 88.16}, type = {Technical Report} } @InCollection{ francois.mcdonald.ea:uruguay, author = {J. F. Francois and B. McDonald and H. Nordstrom}, title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, booktitle = {The {U}ruguay Round and the Developing Economies}, address = {New York}, editors = {W. Martin and L. A. Winters}, publisher = {Cambridge University Press} } @InCollection{ francois.mcdonald.ea:uruguay*1, author = {J. F. Francois and B. McDonald and H. Nordstrom}, title = {The {U}ruguay Round: {A} Global Analysis}, booktitle = {Challenges and Opportunities for East Asian Trade}, address = {Cambridge}, editors = {D. Robertson}, publisher = {Cambridge University Press} } @Article{ frank.wolfe:algorithm, author = {M. Frank and P. Wolfe}, title = {An Algorithm for Quadratic Programming}, journal = {Naval Research Logistics Quarterly}, year = {1956}, volume = {3}, pages = {95--110} } @Article{ freund.nachtigal:qmrpack, author = {R. W. Freund and N. M. Nachtigal}, title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, journal = {{ACM} Transactions on Mathematical Software}, year = {1996}, volume = {22}, pages = {46--77} } @InProceedings{ freund.schapire:experiments, author = {Y. Freund and R. E. Schapire}, title = {Experiments with a New Boosting Algorithm}, booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, pages = {148--156}, year = {1996}, editor = {L. Saitta}, publisher = {Morgan Kaufmann} } @Unpublished{ freund.todd:barrier, author = {Robert M. Freund and Michael J. Todd}, title = {Barrier functions and interior-point algorithms for linear programming with zero-, one-, or two-sided bounds on the variables}, year = {1992}, month = jul } @Article{ friedman.chernina:iterative, author = {V. M. Friedman and V. S. Chernina}, title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, note = {In Russian}, journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, volume = {1}, pages = {116--120}, year = {1967} } @Article{ friesz.bernstein.ea:day-to-day, author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. Ganjalizadeh}, title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information Systems}, journal = {Operations Research}, year = {1994}, volume = {42}, pages = {1120--1136} } @Article{ friesz.tobin.ea:nonlinear, author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General Derived Demand Network Equilibrium Problem}, journal = {Journal of Regional Science}, year = {1983}, volume = {23}, pages = {337--359} } @Article{ friesz:network, author = {T. L. Friesz}, title = {Network Equilibrium, Design and Aggregation}, journal = {Transportation Research}, volume = {19A}, year = {1985}, pages = {413--427} } @Unpublished{ frisch:logarithmic, author = {K. R. Frisch}, title = {The Logarithmic Potential Method of Convex Programming}, year = {1955}, note = {Unpublished manuscript, University Institute of Economics, Oslo} } @Book{ fukunaga:statistical, author = {K. Fukunaga}, title = {Statistical Pattern Recognition}, year = {1990}, publisher = {Academic Press}, address = {New York} } @Article{ fukushima.luo.ea:globally, author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical Programs with Linear Complementarity Constraints}, journal = {Computational Optimization and Applications}, year = {1998}, volume = {10}, pages = {5--34} } @Article{ fukushima:equivalent, author = {M. Fukushima}, title = {Equivalent Differentiable Optimization Problems and Descent Methods for Asymmetric Variational Inequality Problems}, journal = {Mathematical Programming}, year = {1992}, volume = {53}, pages = {99--110} } @Article{ fukushima:primal, author = {M. Fukushima}, title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone Mappings with Application to the Traffic Equilibrium Problem}, journal = {Mathematical Programming}, year = {1996}, volume = {72}, pages = {1--15} } @Article{ gabay.mercier:dual, author = {D. Gabay and B. Mercier}, title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via Finite Element Approximations}, journal = {Computational Mathematics and Applications}, year = {1976}, volume = {2}, pages = {17--48} } @InCollection{ gabay:applications, author = {D. Gabay}, title = {Applications of the Method of Multipliers to Variational Inequalities}, booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value Problems}, publisher = {North-Holland}, year = {1983}, editor = {M. Fortin and R. Glowinski}, address = {Amsterdam} } @Unpublished{ gabriel.bernstein:path, author = {S. A. Gabriel and D. Berstein}, title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic Equilibrium Problem}, note = {Draft, 1995} } @TechReport{ gabriel.kydes:nonlinear, author = {S. A. Gabriel and A. S. Kydes}, title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling System}, institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, year = {1995}, type = {Preprint}, number = {MCS-P504-0395}, address = {Argonne, Illinois}, month = mar } @InProceedings{ gabriel.more:smoothing, crossref = {ferris.pang:complementarity}, author = {S. A. Gabriel and J. J. Mor\'{e}}, title = {Smoothing of Mixed Complementarity Problems} } @Article{ gabriel.pang:inexact, author = {S. A. Gabriel and J. S. Pang}, title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, journal = {Computational Optimization and Applications}, year = {1992}, volume = {1}, pages = {67--91} } @InCollection{ gabriel.pang:trust, author = {S. A. Gabriel and J. S. Pang}, title = {A Trust Region Method for Constrained Nonsmooth Equations}, booktitle = {Large--Scale Optimization: State of the Art}, publisher = {Kluwer Academic Publishers}, year = {1994}, editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, pages = {159--186} } @PhDThesis{ gabriel:algorithms, author = {S. A. Gabriel}, title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and Extensions}, school = {The Johns Hopkins University}, year = {1992}, address = {Baltimore, Maryland} } @Article{ gafni.bertsekas:two-metric, author = {E. M. Gafni and D. P. Bertsekas}, title = {Two-Metric Projection Methods for Constrained Optimization}, journal = {SIAM Journal on Control and Optimization}, year = {1984}, volume = {22}, pages = {936--964} } @InProceedings{ gaivoronski:convergence, author = {A. A. Gaivoronski}, title = {Convergence of Parallel Backpropagation for Neural Networks}, booktitle = {SIAM Journal on Optimization}, year = {1994}, note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, submitted} } @Misc{ gaivoronski:private, author = {A. A. Gaivoronski}, title = {Private Communication}, year = {1992}, month = nov, address = {ITALTEL, Milan} } @Book{ gale:theory, author = {D. Gale}, title = {The Theory of Linear Economic Models}, year = {1960}, publisher = {McGraw-Hill Book Company}, address = {New York} } @Book{ gallant:neural, author = {S. I. Gallant}, title = {Neural Network Learning and Expert Systems}, year = {1993}, publisher = {MIT Press}, address = {Cambridge, Massachusetts} } @InProceedings{ ganti.gehrke.ea:framework, author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, title = {A Framework for Measuring Changes in Data Characteristics}, booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, publisher = {ACM Press}, year = {1999}, isbn = {1-58113-062-7}, pages = {126--137} } @Book{ ganz:gamma, author = {J. C. Ganz}, title = {Gamma Knife Surgery}, publisher = {Springer-Verlag Wien}, year = {1997}, address = {Austria} } @TechReport{ gao:nonlinear, author = {Y. Gao}, title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral Conditions}, type = {Manuscript}, institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, month = oct, year = {1994} } @Article{ garcia-palomares.mangasarian:superlinearly, author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained Optimization Problems}, journal = {Mathematical Programming}, year = {1976}, volume = {11}, pages = {1--13} } @Article{ garcia-palomares.restuccia:global, author = {U. M. {Garcia--Palomares} and A. Restuccia}, title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, journal = {Mathematical Programming}, year = {1981}, volume = {21}, pages = {290--300} } @InProceedings{ garcia-palomares:superlinearly, author = {U. M. {Garcia--Palomares}}, title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, crossref = {mangasarian.meyer.ea:nonlinear*2}, pages = {101--119} } @Article{ garcia.gould:theorem, author = {C. B. Garcia and F. J. Gould}, title = {A Theorem on Homotopy Paths}, journal = {Mathematics of Operations Research}, year = {1978}, volume = {3}, pages = {282--289} } @Book{ garcia.zangwill:pathways, author = {C. B. Garcia and W. I. Zangwill}, title = {Pathways to Solutions, Fixed Points, and Equilibria}, year = {1981}, publisher = {Prentice-Hall, Inc}, address = {Englewood Cliffs, New Jersey} } @Book{ garey.johnson:computers, author = {M. R. Garey and D. S. Johnson}, title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, year = {1979}, publisher = {W.H. Freeman and Company}, address = {San Francisco} } @Article{ garey.tarjan.ea:one-processor, author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, journal = {Mathematics of Operations Research}, year = {1988}, volume = {13}, pages = {330--348} } @Book{ garfinkel.nemhauser:integer, author = {R. S. Garfinkel and G. L. Nemhauser}, title = {Integer Programming}, year = {1972}, publisher = {John Wiley \& Sons}, address = {New York} } @Book{ gass:linear, author = {S. Gass}, title = {Linear Programming Methods and Applications}, edition = {Fifth}, publisher = {Boyd and Fraser Publishing Company}, address = {Danvers, Massachusetts}, year = {1985} } @InProceedings{ gay:combining, author = {D. M. Gay}, title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, booktitle = {Sparse Matrix Proceedings 1978}, editor = {I. S. Duff and G. W. Stewart}, year = {1978}, organization = {SIAM}, address = {Philadelphia, Pennsylvania}, pages = {313--334} } @Article{ gay:electronic, author = {D. M. Gay}, title = {Electronic Mail Distribution of Linear Programming Test Problems}, journal = {{COAL} Newsletter}, year = {1985}, volume = {13}, pages = {10--12} } @TechReport{ gay:hooking, author = {D. M. Gay}, title = {Hooking Your Solver to {AMPL}}, year = {1997}, institution = {Bell Laboratories}, address = {Murray Hill, New Jersey}, note = {Revised 1994, 1997} } @Article{ gay:variant, author = {D. Gay}, title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard Form}, journal = {Mathematical Programming}, year = {1987}, volume = {37}, pages = {81--90} } @Article{ geiger.kanzow:resolution, author = {C. Geiger and C. Kanzow}, title = {On the Resolution of Monotone Complementarity Problems}, journal = {Computational Optimization and Applications}, volume = {5}, year = {1996}, pages = {155--173} } @Book{ geist.beguelin.ea:pvm, author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and V. S. Sunderam}, title = {{PVM}: Parallel Virtual Machine}, publisher = {MIT Press}, address = {Cambridge, Massachusetts}, year = {1994} } @Article{ gendron.crainic:parallel, author = {B. Gendron and T. G. Crainic}, title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, journal = {Operations Research}, year = {1994}, volume = {42}, pages = {1042--1060} } @Article{ george:automatic, author = {A. George}, title = {An automatic one-way dissection algorithm for irregular finite-element problems}, journal = {SIAM Journal on Numerical Analysis}, vol = {17}, pages = {740--751}, year = {1980} } @InProceedings{ georges-schleuter:asparagos, crossref = {schaeffer:third}, author = {M. Georges--Schleuter}, title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, pages = {416--421} } @Article{ georgiou:comments, author = {G. M. Georgiou}, title = {Comments On Hidden Nodes in Neural Nets}, journal = {IEEE Transactions on Circuits and Systems}, year = {1991}, volume = {38}, pages = {1410} } @TechReport{ gertz.linderoth.ea:object-oriented, author = {M. Gertz and J. Linderoth and S. Wright}, title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, institution = {MCS Division, Argonne National Laboratory}, year = {in preparation} } @Article{ ghellinck.vial:polynomial, author = {G. de Ghellinck and J.--Ph. Vial}, title = {A Polynomial {N}ewton Method for Linear Programming}, journal = {Algorithmica}, year = {1986}, volume = {1}, pages = {425--453} } @InCollection{ gilbert.ng:predicting, author = {J. R. Gilbert and E. Ng}, title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, year = {1993}, booktitle = {Graph Theory and Sparse Matrix Computation}, editor = {A. George and J. Gilbert and J. Liu}, publisher = {Springer-Verlag} } @Article{ gilbert-lemarechal, author = {J. C. Gilbert and C. Lemarechal}, title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, journal = {Mathematical Programming}, year = {1989}, volume = {45}, pages = {407--434} } @Article{ gill.murray.ea:computing, author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, title = {Computing Forward-Difference Intervals for Numerical Optimization}, journal = {SIAM Journal on Scientific and Statistical Computing}, year = {1983}, volume = {4}, pages = {310--321} } @Article{ gill.murray.ea:maintaining, author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, title = {Maintaining {LU} Factors of a General Sparse Matrix}, year = {1987}, journal = {Linear Algebra and Its Applications}, volume = {88/89}, pages = {239--270} } @Book{ gill.murray.ea:practical, author = {P. E. Gill and W. Murray and M. H. Wright}, title = {Practical Optimization}, year = {1981}, publisher = {Academic Press}, address = {London} } @Article{ gill.murray.ea:practical*1, author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, journal = {Mathematical Programming}, year = {1989}, volume = {45}, pages = {437--474} } @Article{ gill.murray.ea:projected, author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence to {K}armarkar's Projective Method}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {183--209} } @Article{ gill.murray:newton-type, author = {P. E. Gill and W. Murray}, title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, journal = {Mathematical Programming}, year = {1974}, volume = {7}, pages = {311--350} } @InProceedings{ gill.murray:nonlinear, author = {P. E. Gill and W. Murray}, title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, booktitle = {Numerical Analysis, Dundee 1975}, year = {1976}, editor = {G. A. Watson}, publisher = {Springer-Verlag}, address = {Berlin}, note = {Lecture Notes in Mathematics 506} } @Book{ ginsburgh.waelbroeck:activity, author = {V. Ginsburgh and J. Waelbroeck}, title = {Activity Analysis and General Equilibrium Modelling}, publisher = {North--Holland}, year = {1981}, address = {Amsterdam} } @Article{ glad.goldstein:errors, author = {T. Glad and A. Goldstein}, title = {Optimization of Functions Whose Values are Subject to Small Errors}, journal = {BIT}, year = {1977}, volume = {17}, pages = {160--169} } @Article{ glad.polak:multiplier, author = {T. Glad and E. Polak}, title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, journal = {Mathematical Programming}, year = {1979}, volume = {17}, pages = {140--155} } @Book{ glashoff.gustafson:linear, author = {K. Glashoff and S.--\AA. Gustafson}, title = {Linear Optimization and Approximation}, year = {1983}, publisher = {Springer-Verlag}, address = {New York} } @Article{ glover:improved, author = {F. Glover}, title = {Improved Linear Programming Models for Discriminant Analysis}, journal = {Decision Sciences}, year = {1990}, volume = {21}, pages = {771--785} } @Book{ glasserman:gradient, author = {P. Glasserman}, title = {Gradient Estimation via Perturbation Analysis}, publisher = {Kluwer}, year = {1991}, address = {Norwell, MA} } @Article{ glover:tabu, author = {F. Glover}, title = {Tabu Search -- Part 1}, journal = {ORSA Journal on Computing}, year = {1989}, volume = {1}, pages = {190--206} } @Article{ glowinski.marroco:sur, author = {R. Glowinski and A. Marroco}, title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, year = {1975}, volume = {9(R-2)}, pages = {41--76} } @TechReport{ goeleven.nguyen:convergence, author = {D. Goeleven and V. H. Nguyen}, title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, institution = {Department of Mathematics, Facultes Universitaires de Namur}, year = {1992}, address = {B-5000 Namur, Belgium} } @Book{ goldberg:genetic, author = {D. E. Goldberg}, title = {Genetic Algorithms in Search, Optimization and Machine Learning}, year = {1989}, publisher = {Addison-Wesley}, address = {Reading MA} } @Article{ golden.skiscim:simulated, author = {B. L. Golden and C. C. Skiscim}, title = {Using Simulated Annealing to Solve Routing and Location Problems}, journal = {Naval Research Logistics Quarterly}, year = {1989}, volume = {33}, pages = {261--279} } @Article{ goldfarb.reid:practical, author = {D. Goldfarb and J. K. Reid}, title = {A Practical Steepest--Edge Simplex Algorithm}, journal = {Mathematical Programming}, year = {1977}, volume = {12}, pages = {361--371} } @InProceedings{ goldman.tucker:theory, author = {A. J. Goldman and A. W. Tucker}, title = {Theory of Linear Programming}, booktitle = {Linear Inequalities and Related Systems}, year = {1956}, editor = {H. W. Kuhn and A. W. Tucker}, publisher = {Princeton University Press}, address = {Princeton, New Jersey}, pages = {53--97} } @Book{ goldstein:constructive, author = {A. A. Goldstein}, title = {Constructive Real Analysis}, year = {1967}, publisher = {Harper and Row}, address = {New York} } @Article{ golshtein:block, author = {Ye. G. Golshtein}, title = {The Block Method of Convex Programming}, journal = {Soviet Mathematics Doklady}, year = {1986}, volume = {33}, pages = {584--587} } @Article{ golshtein:general, author = {Ye. G. Golshtein}, title = {A General Approach to Decomposition of Optimization Systems}, journal = {Soviet Journal of Computer and Systems Sciences}, year = {1987}, volume = {3}, pages = {105--114} } @Article{ golub.kahan:calculating, author = {G. H. Golub and W. Kahan}, title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, journal = {SIAM Journal on Numerical Analysis}, year = {1965}, volume = {2}, pages = {205--224} } @Book{ golub.vanloan:matrix, author = {G. H. Golub and C. F. {Van Loan}}, title = {Matrix Computations}, year = {1996}, publisher = {The John Hopkins University Press}, address = {Baltimore, Maryland}, edition = {Third} } @TechReport{ gomez.barron:exponential, author = {S. Gom\'{e}z and C. Barr\'{o}n}, title = {The Exponential Tunneling Method}, institution = {Universidad Nacional Autonoma de Mexico}, year = {1991}, type = {Serie Reportes de Investigacion}, number = {3}, address = {Mexico} } @Article{ gondzio:multiple, author = {J. Gondzio}, title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, journal = {Computational Optimization and Applications}, year = {1996}, volume = {6}, pages = {137--156} } @TechReport{ gonzaga:algorithm, author = {C. C. Gonzaga}, title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) operations}, institution = {Electronics Research Laboratory, University of California}, year = {1987}, address = {Berkeley, California}, number = {UCB/ERL M87/10}, type = {Memorandum} } @Article{ gould.tolle:necessary, author = {F. J. Gould and J. W. Tolle}, title = {A Necessary and Sufficient Qualification for Constrained Optimization}, journal = {SIAM Journal on Applied Mathematics}, year = {1971}, volume = {20}, pages = {164--172} } @InProceedings{ goux.kulkarni.ea:enabling, author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance Distributed Computing}, year = {2000} } @Article{ gowda.pang:basic, author = {M. S. Gowda and J. S. Pang}, title = {The Basic Theorem of Complementarity Revisited}, journal = {Mathematical Programming}, year = {1993}, volume = {58}, pages = {161--178} } @Article{ gowda.pang:boundedness, author = {M. S. Gowda and J. S. Pang}, title = {On the Boundedness and Stability of Solutions to the Affine Variational Inequality Problem}, journal = {SIAM Journal on Control and Optimization}, year = {1994}, volume = {32}, pages = {421--441} } @Article{ gowda.pang:stability, author = {M. S. Gowda and J. S. Pang}, title = {Stability analysis of variational inequalities and nonlinear complementarity problems, via the mixed linear complementarity problem and degree theory}, journal = {Mathematics of Operations Research}, year = {1994}, volume = {19}, pages = {831--879} } @Article{ gowda.sznajder:generalizations, author = {M. S. Gowda and R. Sznajder}, title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and Horizontal {LCP}s}, journal = {Linear Algebra and Its Applications}, year = {1995}, volume = {223/224}, pages = {695--715} } @Article{ gowda.sznajder:generalized, author = {M. S. Gowda and R. Sznajder}, title = {The Generalized Order Linear Complementarity Problem}, journal = {SIAM Journal on Matrix Analysis and Applications}, year = {1994} } @Article{ gowda:analysis, author = {M. S. Gowda}, title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine Function via its Recession Function}, journal = {SIAM Journal on Matrix Analysis and Applications}, year = {1996}, volume = {17}, pages = {594--609} } @Article{ gowda:applications, author = {M. S. Gowda}, title = {Applications of Degree Theory to Linear Complementarity Problems}, journal = {Mathematics of Operations Research}, year = {1993}, volume = {18}, pages = {868--879} } @Article{ grant.woo:clinical, author = {W. I. Grant and S. Y. Woo}, title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy Delivery}, journal = {Seminars in Radiation Oncology}, year = {1999}, volume = {9}, pages = {99--107} } @Article{ greenberg.hegerich:branch, author = {H. Greenberg and R. L. Hegerich}, title = {A Branch Search Algorithm for the Knapsack Problem}, journal = {Management Science}, year = {1970}, volume = {16}, pages = {327--332} } @InCollection{ grefenstette:incorporating, crossref = {davis:genetic}, author = {J. J. Grefenstette}, title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} } @Book{ griewank.corliss:automatic, editor = {A. Griewank and G. F. Corliss}, title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, publisher = {SIAM}, year = {1991}, address = {Philadelphia, Pennsylvania} } @Article{ griewank.juedes.ea:adol-c, author = {A. Griewank and D. Juedes and J. Utke}, title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written in {C}/{C}++}, journal = {{ACM} Transactions on Mathematical Software}, year = {1996}, volume = {22}, pages = {131--167} } @Article{ griffith.stewart:nonlinear, author = {R. E. Griffith and R. A. Stewart}, title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing Systems}, journal = {Management Science}, year = {1961}, volume = {7}, pages = {379--392} } @Article{ grinold:mathematical, author = {R. C. Grinold}, title = {Mathematical Methods for {PA}ttern Classification}, journal = {Management Science}, year = {1972}, volume = {19}, pages = {272--289} } @Article{ grippo.lampariello.ea:class, author = {L. Grippo and F. Lampariello and S. Lucidi}, title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, journal = {Numerische Mathematik}, year = {1991}, volume = {59}, pages = {779--805} } @Article{ grippo.lampariello.ea:global, author = {L. Grippo and F. Lampariello and S. Lucidi}, title = {Global Convergence and Stabilization of Unconstrained Minimization Methods Without Derivatives}, journal = {Journal of Optimization Theory and Applications}, year = {1988}, volume = {56}, pages = {385--406} } @Article{ grippo.lampariello.ea:nonmonotone, author = {L. Grippo and F. Lampariello and S. Lucidi}, title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, journal = {SIAM Journal on Numerical Analysis}, year = {1986}, volume = {23}, pages = {707--716} } @Misc{ grippo:private, author = {L. Grippo}, title = {Private Communication}, year = {1992}, address = {Universita degli Studi di Roma ``La Sapienza'',Roma} } @Article{ grotschel.lovasz.ea:ellipsoid, author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, journal = {Combinatorica}, year = {1981}, volume = {1}, pages = {169--197} } @Article{ guignard:generalized, author = {M. Guignard}, title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a {B}anach Space}, journal = {SIAM Journal on Control and Optimization}, year = {1969}, volume = {7}, pages = {232--241} } @Article{ guler.ye:convergence, author = {O. G{\"{u}}ler and Y. Ye}, title = {Convergence Behavior of Interior--Point Algorithms}, journal = {Mathematical Programming}, year = {1993}, volume = {60}, pages = {215--228} } @Article{ guler:existence, author = {O. G{\"{u}}ler}, title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone Complementarity Problems}, journal = {Mathematics of Operations Research}, year = {1993}, volume = {18}, pages = {128--147} } @Article{ guler:generalized, author = {O. G{\"{u}}ler}, title = {Generalized Linear Complementarity Problems}, journal = {Mathematics of Operations Research}, year = {1995}, volume = {20}, pages = {441--448} } @Article{ gupta.sen:minimizing, author = {S. Gupta and T. Sen}, title = {Minimizing the Range of Lateness on a Single Machine}, journal = {Journal of the Operational Research Society}, year = {1984}, volume = {35}, pages = {853--857} } @InCollection{ gustafson:numerical, author = {S.-\AA. Gustafson}, title = {On Numerical Analysis in Semi-Infinite Programming}, booktitle = {Semi-Infinite Programming}, year = {1979}, editor = {R. Hettich}, publisher = {Springer-Verlag}, address = {Berlin} } @Article{ gustafsson.lind.ea:simultaneous, author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns or compensation filters using a generalized pencil beam algorithm}, journal = {Medical Physics}, year = {1995}, volume = {22}, number = {7}, pages = {1141--1156} } @PhDThesis{ ha:decomposition, author = {C. D. Ha}, title = {Decomposition Methods for Structured Convex Programming}, year = {1980}, school = {Department of Industrial Engineering, University of Wisconsin--Madison} } @TechReport{ haakonsen.mathiesen:toward, author = {L. Haakonsen and L. Mathiesen}, title = {Toward a more comprehensive cost measure for {CO2}-reductions}, institution = {NHH, Bergen}, year = {1995}, type = {Discussion Paper}, number = {3/95} } @Article{ haaland.norman.ea:vemod, author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, journal = {Scandinavian Journal of Economics}, year = {1987} } @Article{ haarhoff.buys:method, author = {P. C. Haarhoff and J. D. Buys}, title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear Constraints}, journal = {Computer Journal}, year = {1970}, volume = {12}, pages = {178--184} } @Article{ habetler.kostreva:direct, author = {G. J. Habetler and M. M. Kostreva}, title = {On a direct algorithm for nonlinear complementarity problems}, journal = {SIAM Journal on Control and Optimization}, volume = {16}, year = {1978}, pages = {504--511} } @Book{ hadamard:cauchys, author = {J. Hadamard}, title = {Cauchy's Problem in Linear Partial Differential Equations}, year = {1923}, publisher = {Yale University Press} } @Article{ haddock.mittenthal:simulation, author = {J. Haddock and J. Mittenthal}, title = {Simulation optimization using simulated annealing}, journal = {Comput. Ind. Eng.}, year = {1992}, volume = {22}, pages = {387--395} } @TechReport{ hamala:general, author = {M. Hamala}, title = {A General Approach to Interior Point Methods with Linear Parameter for Mathematical Programming}, institution = {Royal Institute of Technology}, year = {1978}, number = {1978--20}, type = {Department of Mathematics Paper TRITA--MAT} } @Article{ han.mangasarian:dual, author = {S.--P. Han and O. L. Mangasarian}, title = {A Dual Differentiable Exact Penalty Function}, journal = {Mathematical Programming}, year = {1983}, volume = {25}, pages = {293--301} } @Article{ han.mangasarian:exact, author = {S.--P. Han and O. L. Mangasarian}, title = {Exact Penalty Functions in Nonlinear Programming}, journal = {Mathematical Programming}, year = {1979}, volume = {17}, pages = {251--269} } @Article{ han.pang.ea:globally, author = {S.--P. Han and J. S. Pang and N. Rangaraj}, title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, journal = {Mathematics of Operations Research}, year = {1992}, volume = {17}, pages = {586--607} } @Article{ han:decomposition, author = {S.--P. Han}, title = {A Decomposition Method and its Application to Convex Programming}, journal = {Mathematics of Operations Research}, year = {1989}, volume = {14}, pages = {237--248} } @Article{ han:globally, author = {S.--P. Han}, title = {A Globally Convergent Method for Nonlinear Programming}, journal = {Journal of Optimization Theory and Applications}, year = {1977}, volume = {22}, pages = {297--309} } @Article{ han:superlinearly, author = {S.--P. Han}, title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear Programming Problems}, journal = {Mathematical Programming}, year = {1976}, volume = {11}, pages = {263--282} } @Article{ hansen.koopmans:definition, author = {T. Hansen and T. C. Koopmans}, title = {On the Definition and Computation of a Capital Stock Invariant Under Optimization}, journal = {Journal of Economic Theory}, year = {1972}, volume = {5}, pages = {487--523} } @InCollection{ harker.pang:damped, author = {P. T. Harker and J. S. Pang}, title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, booktitle = {Computational Solution of Nonlinear Systems of Equations}, publisher = {AMS}, year = {1990}, editor = {E. L. Allgower and K. Georg}, number = {26}, series = {Lectures on Applied Mathematics}, address = {Providence, Rhode Island}, pages = {265--284} } @Article{ harker.pang:existence, author = {P. T. Harker and J. S. Pang}, title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium Constraints}, journal = {Operations Research Letters}, year = {1988}, volume = {7}, pages = {61--64} } @Article{ harker.pang:finite-dimensional, author = {P. T. Harker and J. S. Pang}, title = {Finite--dimensional variational inequality and nonlinear complementarity problems: {A} survey of theory, algorithms and applications}, journal = {Mathematical Programming}, year = {1990}, volume = {48}, pages = {161--220} } @Article{ harker.xiao:newtons, author = {P. T. Harker and B. Xiao}, title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} {B}--Differentiable Equation Approach}, journal = {Mathematical Programming}, year = {1990}, volume = {48}, pages = {339--358} } @Article{ harker:accelerating, author = {P. T. Harker}, title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for Finite--Dimensional Variational Inequalities}, journal = {Mathematical Programming}, year = {1988}, volume = {41}, pages = {29--50} } @Article{ harker:generalized, author = {P. T. Harker}, title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, journal = {European Journal of Operations Research}, volume = {54}, pages = {81--94}, year = {1987} } @Book{ harker:lectures, author = {P. T. Harker}, title = {Lectures on Computation of Equilibria with Equation--Based Methods}, publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, year = {1993}, series = {CORE Lecture Series} } @Article{ harris:pivot, author = {P. M. J. Harris}, title = {Pivot Selection Methods of the {D}evex {LP} Code}, journal = {Mathematical Programming}, year = {1973}, volume = {5}, pages = {1--28} } @InCollection{ harrison.kristrom:carbon, author = {G. W. Harrison and B. Kristrom}, title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, booktitle = {Environment and Transport in Economic Modelling}, publisher = {Kluwer Academic Publishers}, year = {1997}, editor = {R. Roson and K. A. Small}, address = {Amsterdam} } @Article{ harrison.rutherford.ea:increased, author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, journal = {Journal of Economic Integration}, year = {1996}, volume = {11}, pages = {332--365} } @Article{ harrison.rutherford.ea:liberalizing, author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, title = {Liberalizing Agriculture in the {E}uropean {U}nion}, journal = {Journal of Policy Modeling}, year = {1995}, volume = {17} } @Article{ harrison.rutherford.ea:quantifying, author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, title = {Quantifying the {U}ruguay Round}, journal = {Finance and Development}, year = {1995}, volume = {32}, pages = {38--41} } @InProceedings{ harrison.rutherford.ea:quantifying*1, author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, title = {Quantifying the {U}ruguay Round}, year = {1996}, booktitle = {The {U}ruguay Round and the Developing Economies}, address = {New York}, editors = {W. Martin and L. A. Winters}, publisher = {Cambridge University Press} } @Article{ harrison.rutherford.ea:quantifying*2, author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, title = {Quantifying the {U}ruguay Round}, journal = {The Economic Journal}, year = {1997}, volume = {107}, pages = {1405--1430} } @Article{ harrison.rutherford.ea:trade, author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, journal = {The World Bank Economic Review}, year = {1993}, volume = {7}, pages = {191--217} } @Article{ hartman.stampacchia:nonlinear, author = {P. Hartman and G. Stampacchia}, title = {On some nonlinear differential-functional equations}, journal = {Acta Mathematica}, year = {1966}, volume = {115}, pages = {271--310} } @Book{ harvey:forecasting, author = {Andrew C. Harvey}, title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, publisher = {Cambridge University Press}, address = {New York, NY}, year = {1989} } @Article{ haurie.marcotte:relationship, author = {A. Haurie and P. Marcotte}, title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, journal = {Networks}, year = {1985}, volume = {15}, pages = {295--308} } @Article{ hearn.lawphongpanich.ea:restricted, author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, title = {Restricted Simplicial Decomposition: Computation and Extensions}, journal = {Mathematical Programming Study}, year = {1987}, volume = {31}, pages = {99--118} } @Article{ hearn:gap, author = {D. W. Hearn}, title = {The Gap Function of a Convex Program}, journal = {Operations Research Letters}, year = {1982}, volume = {1}, pages = {67--71} } @Article{ hedlund.gustavsson:design, author = {P. Hedlund and A. Gustavsson}, title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence Ability}, journal = {Analytica Chimica Acta}, year = {1992}, volume = {259}, pages = {243--256} } @Article{ helgason.kennington.ea:parallelization, author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, title = {A Parallelization of the Simplex Method}, journal = {Annals of Operations Research}, year = {1988}, volume = {14}, pages = {17--40} } @Article{ helgason.kennington.ea:polynomially, author = {Richard Helgason and James Kennington and H. Lall}, title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, journal = {Mathematical Programming}, year = {1980}, volume = {18}, pages = {338--343} } @Book{ henderson.quandt:microeconomic, author = {J. M. Henderson and R. E. Quandt}, title = {Microeconomic Theory}, publisher = {McGraw--Hill}, address = {New York}, year = {1980}, edition = {Third} } @TechReport{ hendrickson.leland:chaco, author = {B. Hendrickson and R. Leland}, title = {The {C}haco User's Guide: Version 2}, institution = {Sandia National Laboratories}, type = {Technical Report}, number = {SAND94-2692}, address = {Albuquerque, New Mexico}, year = {1994} } @InProceedings{ hendrickson.leland:multilevel, author = {B. Hendrickson and R. Leland}, title = {A Multilevel Algorithm for Partitioning Graphs}, booktitle = {Proceedings of Supercomputing '95}, year = {1995} } @Book{ hertz.krogh.ea:introduction, author = {J. Hertz and A. Krogh and R. G. Palmer}, title = {Introduction to the Theory of Neural Computation}, year = {1991}, publisher = {Addison-Wesley}, address = {Redwood City, California} } @Article{ hertz.werra:tabu, author = {A. Hertz and D. de Werra}, title = {Using {T}abu Search techniques for Graph Coloring}, journal = {Computing}, year = {1987}, volume = {29}, pages = {345--351} } @InCollection{ hettich:review, author = {R. Hettich}, title = {A Review of Numerical Methods for Semi-Infinite Optimization}, booktitle = {Semi-Infinite Programming and Applications}, year = {1983}, editor = {A. V. Fiacco and K. O. Kortanek}, publisher = {Springer-Verlag}, address = {Berlin} } @Article{ highleyman:note, author = {W. H. Highleyman}, title = {A Note on Linear Separation}, journal = {IRE Transactions on Electronic Computers}, year = {1961}, volume = {10}, pages = {777--778} } @Article{ hildreth:quadratic, author = {C. Hildreth}, title = {A Quadratic Programming Procedure}, journal = {Naval Research Logistics Quarterly}, year = {1957}, volume = {4}, pages = {79--85}, note = {Erratum, p. 361} } @Book{ himmelblau:applied, author = {D. M. Himmelblau}, title = {Applied Nonlinear Programming}, year = {1972}, publisher = {McGraw--Hill}, address = {New York} } @Book{ hiriart-urruty.lemarechal:convex, author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, title = {Convex Analysis and Minimization Algorithms {I}}, year = {1993}, publisher = {Springer Verlag}, address = {Berlin}, volume = {305}, series = {Grundlehren der mathematischen Wissenschaften} } @TechReport{ hironaka:introduction, author = {H. Hironaka}, title = {Introduction to real-analytic sets and real-analytic maps}, institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, year = {1973}, type = {Technical Report}, address = {Pisa, Italy} } @Article{ ho.lee.ea:decomposition, author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, title = {Decomposition of Linear Programs Using Parallel Computation}, journal = {Mathematical Programming}, year = {1988}, volume = {42}, pages = {391--405} } @Article{ ho.loute:computational, author = {J. K. Ho and E. Loute}, title = {Computational Experience with Advanced Implementation of Decomposition Algorithms for Linear Programming}, journal = {Mathematical Programming}, year = {1983}, volume = {27}, pages = {283--290} } @Book{ hock.schittkowski:test, author = {W. Hock and K. Schittkowski}, title = {Test Examples for Nonlinear Programming Codes}, volume = {187}, series = {Lecture Notes in Economics and Mathematical Systems}, year = {1981}, publisher = {Springer Verlag}, address = {Berlin, Germany} } @Book{ hockney.jesshope:parallel, author = {R. W. Hockney and C. R. Jesshope}, title = {Parallel Computers 2}, publisher = {Adam Hilger}, year = {1988}, address = {Bristol} } @Article{ hoffman:approximate, author = {A. J. Hoffman}, title = {On Approximate Solutions of Systems of Linear Inequalities}, journal = {Journal of Research of the National Bureau of Standards}, year = {1952}, volume = {49}, pages = {263--265} } @Article{ hogan:comments, author = {W. W. Hogan}, title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis for the {USA}}, journal = {The Energy Journal}, year = {1990}, volume = {11}, pages = {75--84} } @Article{ hogan:energy, author = {W. W. Hogan}, title = {Energy Policy Models for {P}roject {I}ndependence}, journal = {Computers \& Operations Research}, year = {1975}, volume = {2}, pages = {251--271} } @Book{ holland:adaptation, author = {J. Holland}, title = {Adaptation in Natural and Artificial Systems}, year = {1975}, publisher = {The University of Michigan Press}, address = {Ann Arbor, Michigan} } @Article{ holmes.mackie:comparison, author = {T. Holmes and T. R. Mackie}, title = {A comparison of three inverse treatment planning algorithms}, journal = {Physics in Medicine and Biology}, year = {1994}, volume = {39}, number = {1}, pages = {91--106} } @Article{ holmes.mackie:filtered, author = {T. Holmes and T. R. Mackie}, title = {A filtered backprojection dose calculation method for inverse treatment planning}, journal = {Medical Physics}, year = {1994}, volume = {21}, number = {2}, pages = {303--313} } @Article{ hooke.jeeves:direct, author = {R. Hooke and T. A. Jeeves}, title = {Direct Search Solution of Numerical and Statistical Problems}, journal = {Journal of Associated Computing Machinery}, year = {1961}, volume = {8}, pages = {212--229} } @Article{ hoppe.mittelmann:multi-grid, author = {R. H. W. Hoppe and H. D. Mittelmann}, title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational Inequalities}, journal = {Journal of Computational and Applied Mathematics}, year = {1989}, volume = {26}, pages = {35--46} } @Book{ horn.johnson:matrix, author = {R. A. Horn and C. R. Johnson}, title = {Matrix Anaysis}, publisher = {Cambridge University Press}, year = {1985}, address = {Cambridge, England} } @Article{ hornik.stinchcombe.ea:multilayer, author = {K. Hornik and M. Stinchcombe and H. White}, title = {Multilayer Feedforward Networks are Universal Approximators}, journal = {Neural Networks}, year = {1989}, volume = {2}, pages = {359--366} } @Article{ horowitz.sahni:computing, author = {E. Horowitz and S. Sahni}, title = {Computing Partitions with Applications to the Knapsack Problem}, journal = {jacm}, year = {1974}, volume = {21}, pages = {277--292} } @Article{ hristov.fallone:continuous, author = {D. H. Hristov and B. G. Fallone}, title = {A continuous penalty function method for inverse treatment planning}, journal = {Medical Physics}, year = {1998}, volume = {25}, number = {2}, pages = {208--223} } @Article{ hu.cheng.ea:numerical, author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical analysis}, journal = {Transactions of the {ASME}}, volume = {116}, year = {1994}, pages = {470--478} } @InProceedings{ hua.sheu:skyscraper, author = {K. A. Hua and S. Sheu}, title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan Video-On-Demand Systems}, year = {1997}, booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, address = {Cannes, France}, pages = {89--100} } @Article{ huang.pang:option, author = {J. Huang and J. S. Pang}, title = {Option Pricing and Linear Complementarity}, journal = {Journal of Computational Finance}, volume = {2}, year = {1998}, pages = {31--60} } @InCollection{ huard:resolution, author = {P. Huard}, title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method of Centers}, booktitle = {Nonlinear Programming}, year = {1967}, editor = {J. Abadie}, publisher = {North--Holland}, address = {Amsterdam}, pages = {207--219} } @Book{ huber:robust, author = {P. J. Huber}, title = {Robust Statistics}, year = {1981}, publisher = {John Wiley}, address = {New York} } @Book{ hudson:piecewise, author = {J. F. P. Hudson}, title = {Piecewise Linear Topology}, publisher = {Benjamin}, address = {New York}, year = {1969} } @InCollection{ hunter.markusen.ea:north, author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, title = {{N}orth {A}merican free trade and the production of finished automobiles}, booktitle = {Modeling North American Economic Integration}, publisher = {Kluwer Academic Publishers}, year = {1995}, editor = {T. Kehoe and P. Kehoe}, pages = {117--130} } @Article{ ibarra.kim:fast, author = {O. H. Ibarra and C. E. Kim}, title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, journal = {jacm}, year = {1975}, volume = {22}, pages = {463--468} } @Article{ ijiri:fundamental, author = {Y. Ijiri}, title = {Fundamental Queries in Aggregation Theory}, journal = {Journal of the American Statistical Association}, year = {1971}, volume = {66}, pages = {766--782} } @Article{ ingargiola.korsh:reduction, author = {G. P. Ingargiola and J. F. Korsh}, title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, journal = {Management Science}, year = {1973}, volume = {20}, pages = {460--463} } @Article{ ioffe:variational, author = {A. D. Ioffe}, title = {Variational Analysis of a Composite Function: {A} Formula for the Lower Second--Order Directional Derivative}, journal = {Journal of Mathematical Analysis and its Applications}, year = {1993} } @Article{ iri.imai:multiplicative, author = {M. Iri and H. Imai}, title = {A Multiplicative Barrier Function Method for Linear Programming}, journal = {Algorithmica}, year = {1986}, volume = {1}, pages = {455--482} } @Article{ isac.goeleven:implicit, author = {G. Isac and D. Goeleven}, title = {The Implicit General Order Complementarity Problem, Models and Iterative Methods}, journal = {Annals of Operations Research}, year = {1993} } @Article{ isac.kostreva:generalized, author = {G. Isac and M. M. Kostreva}, title = {The Generalized Order Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, volume = {19}, pages = {227--232}, year = {1991} } @Book{ isac:complementarity, author = {G. Isac}, title = {Complementarity Problems}, publisher = {Springer-Verlag}, year = {1992}, series = {Lecture Notes in Mathematics}, address = {New York} } @Article{ iusem.svaiter:variant, author = {A. N. Iusem and B. F. Svaiter}, title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New Search Strategy}, journal = {Optimization}, year = {1997}, volume = {42}, pages = {309--321} } @Article{ iusem:convergence, author = {A. N. Iusem}, title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity Problems}, journal = {Mathematical Programming}, year = {1993}, volume = {59}, pages = {33--48} } @Article{ jackson.kutcher.ea:probability, author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel Architecture subject to Non-Uniform Irradiation}, journal = {Medical Physics}, year = {1993}, volume = {20}, pages = {613--625} } @Article{ jackson:optimization, author = {A. Jackson and X. H. Wang and R. Mohan}, title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives (abstract)}, journal = {Medical Physics}, year = {1994}, volume = {21}, pages = {1006} } @TechReport{ jackson:scheduling, author = {J. R. Jackson}, title = {Scheduling a Production Line to Minimize Maximum Tardiness}, institution = {University of California}, year = {1955}, address = {Los Angeles}, number = {43}, type = {Research Report} } @Article{ jansen.roos.ea:polynomiality, author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear Complementarity Problems}, journal = {Mathematical Programming}, volume = {78}, pages = {315--346}, year = {1997} } @Article{ jiang.fukushima.ea:trust, author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, title = {A Trust Region Method for Solving Generalized Complementarity Problems}, journal = {SIAM Journal on Optimization}, volume = {8}, pages = {140--157}, year = {1998} } @Article{ jiang.qi:nonsmooth, author = {H. Jiang and L. Qi}, title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, journal = {SIAM Journal on Control and Optimization}, volume = {35}, pages = {178--193}, year = {1997} } @TechReport{ jiang.ralph:qpecgen, author = {H. Jiang and D. Ralph}, title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic Objectives and Affine Variational Inequality Constraints}, year = {1997}, institution = {Department of Mathematics and Statistics, The University of Melbourne}, address = {Australia} } @TechReport{ jiang.ralph:smooth, author = {H. Jiang and D. Ralph}, title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity Constraints}, year = {1997}, institution = {Department of Mathematics and Statistics, The University of Melbourne}, address = {Australia} } @Article{ jiang:unconstrained, author = {H. Jiang}, title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, journal = {Journal of Global Optimization, forthcoming}, year = {1997} } @Article{ jittorntrum.osborne:strong, author = {K. Jittorntrum and M. R. Osborne}, title = {Strong uniqueness and second order convergence in nonlinear discrete approximation}, journal = {Numerische Mathematik}, year = {1980}, volume = {34}, pages = {439--455} } @InProceedings{ jog.suh.ea:effects, crossref = {schaeffer:third}, author = {P. Jog and J. Y. Suh and D. Van Gucht}, title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a Genetic Algorithm for the Travelling Salesman Problem}, pages = {110--115} } @Article{ jog.suh.ea:parallel, author = {P. Jog and J. Y. Suh and D. Van Gucht}, title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1} } @Article{ johansson.klarbring:rigid, author = {L. Johansson and A. Klarbring}, title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear Complementarity}, journal = {Mechanics of Structures \& Machines}, volume = {20}, pages = {293--319}, year = {1992} } @Article{ johnson.aragon.ea:optimization, author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph Partitioning}, journal = {Operations Research}, year = {1989}, volume = {37}, pages = {865--892} } @Article{ johnson:optimally, author = {R. Johnson}, title = {Optimally Balancing Large Assembly Lines with {FABLE}}, journal = {Management Science}, year = {1988}, volume = {34}, pages = {240--253} } @Article{ johnsson:solving, author = {S. L. Johnsson}, title = {Solving Tridiagonal Systems on Ensemble Architectures}, journal = {SIAM Journal on Scientific and Statistical Computing}, year = {1987}, volume = {8}, pages = {475--489} } @Article{ jorgenson.wilcoxen:reducing, author = {D. W. Jorgenson and P. J. Wilcoxen}, title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, journal = {Resource and Energy Economics}, year = {1993}, volume = {15}, pages = {7--25} } @TechReport{ josephy:hogans, author = {N. H. Josephy}, title = {Hogan's {PIES} Example and {L}emke's Algorithm}, institution = {Mathematics Research Center, University of Wisconsin--Madison}, year = {1979}, address = {Madison, Wisconsin}, number = {1972}, type = {Technical Summary Report} } @TechReport{ josephy:newton, author = {N. H. Josephy}, title = {A {N}ewton Method for the {PIES} Energy Model}, institution = {Mathematics Research Center, University of Wisconsin--Madison}, year = {1979}, address = {Madison, Wisconsin}, number = {1971}, type = {Technical Summary Report} } @PhDThesis{ josephy:newtons, author = {N. H. Josephy}, title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, year = {1979}, school = {Department of Industrial Engineering, University of Wisconsin--Madison} } @TechReport{ josephy:newtons*1, author = {N. H. Josephy}, title = {{N}ewton's Method for Generalized Equations}, institution = {Mathematics Research Center, University of Wisconsin}, year = {1979}, address = {Madison, Wisconsin}, number = {1965}, type = {Technical Summary Report} } @TechReport{ josephy:quasi-newton, author = {N. H. Josephy}, title = {Quasi--{N}ewton Methods for Generalized Equations}, institution = {Mathematics Research Center, University of Wisconsin}, year = {1979}, address = {Madison, Wisconsin}, number = {1966}, type = {Technical Summary Report} } @PhDThesis{ kabbadj:methodes, author = {S. Kabbadj}, title = {Methodes Proximales Entropiques}, school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, year = {1994}, type = {Doctoral Thesis} } @Book{ kall.wallace:stochastic, author = {P. Kall and S. W. Wallace}, title = {Stochastic Programming}, publisher = {John Wiley \& Sons}, year = {1994}, address = {Chichester} } @Article{ kallman.agren.ea:tumor, author = {P. Kallman and A. Agren and A. Brahme}, title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, journal = {International Journal of Radiation Biology}, year = {1992}, volume = {62}, pages = {249--262} } @Misc{ kalvelagen:gams, author = {Erwin Kalvelagen}, title = {The {GAMS} {I/O} Library}, howpublished = {mimeo, GAMS Development Corporation}, year = {1992}, note = {Preliminary Version} } @Article{ kaneko:complete, author = {I. Kaneko}, title = {Complete solution of a class of elastic-plastic structures}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {21}, year = {1980}, pages = {193--209} } @Article{ kaneko:mathematical, author = {I. Kaneko}, title = {A mathematical programming method for the inelastic analysis of reinforced concrete frames}, journal = {International Journal for Numerical Methods in Engineering}, volume = {11}, year = {1977}, pages = {1137--1154} } @Article{ kaneko:piecewise, author = {I. Kaneko}, title = {Piecewise linear elastic-plastic analysis}, journal = {International Journal for Numerical Methods in Engineering}, volume = {14}, year = {1979}, pages = {757--767} } @Article{ kanet:minimizing, author = {J. J. Kanet}, title = {Minimizing the Average Deviation of Job Completion Times about a Common Due Date}, journal = {Naval Research Logistics Quarterly}, year = {1981}, volume = {28}, pages = {643--651} } @Article{ kantorovich:mathematical, author = {L. V. Kantorovich}, title = {Mathematical Methods in the Organization and Planning of Production}, journal = {Management Science}, year = {1960}, volume = {6}, pages = {366--422}, note = {English translation, Russian version 1939} } @Article{ kanzow.fukushima:equivalence, author = {C. Kanzow and M. Fukushima}, title = {Equivalence of the Generalized Complementarity Problem to Differentiable Unconstrained Minimization}, journal = {Journal of Optimization Theory and Applications}, year = {1996}, volume = {90}, pages = {581--603} } @Article{ kanzow.fukushima:theoretical, author = {C. Kanzow and M. Fukushima}, title = {Theoretical and Numerical Investigation of the {D}-gap function for Box-Constrained Variational Inequalities}, journal = {Mathematical Programming}, year = {1998}, volume = {83}, pages = {55--88} } @Article{ kanzow.jiang:continuation, author = {C. Kanzow and H. Jiang}, title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, journal = {Mathematical Programming}, year = {1998}, volume = {81}, pages = {103--125} } @Article{ kanzow.kleinmichel:class, author = {C. Kanzow and H. Kleinmichel}, title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained Optimization}, journal = {Optimization Methods and Software}, year = {1995}, volume = {5}, pages = {173--198} } @Article{ kanzow.kleinmichel:new, author = {C. Kanzow and H. Kleinmichel}, title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity Problems}, journal = {Computational Optimization and Applications}, volume = {11}, pages = {227--251}, year = {1998} } @Article{ kanzow.pieper:jacobian, author = {C. Kanzow and H. Pieper}, title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, journal = {SIAM Journal on Optimization}, year = {1999}, volume = {9}, pages = {342--373} } @Article{ kanzow.qi:qp-free, author = {C. Kanzow and H. -D. Qi}, title = {A {QP}-free constrained {N}ewton-type method for variational inequality problems}, journal = {Mathematical Programming}, year = {1999}, volume = {85}, pages = {81--106} } @Article{ kanzow.yamashita.ea:ncp-functions, author = {C. Kanzow and N. Yamashita and M. Fukushima}, title = {New {NCP}-functions and their properties}, journal = {Journal of Optimization Theory and Applications}, year = {1997}, volume = {94}, pages = {115--135} } @TechReport{ kanzow.zupke:inexact, author = {C. Kanzow and M. Zupke}, title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, year = {1997}, institution = {Institute of Applied Mathematics, University of Hamburg}, type = {Preprint}, number = {127}, address = {Hamburg, Germany} } @Article{ kanzow:approach, author = {C. Kanzow}, title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform {P}-Functions}, journal = {Operations Research Letters}, volume = {20}, year = {1997}, pages = {85--92} } @Article{ kanzow:equation-based, author = {C. Kanzow}, title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, journal = {Optimization Methods and Software}, year = {1994}, volume = {3}, pages = {327--340} } @Article{ kanzow:global, author = {C. Kanzow}, title = {Global Convergence Properties of Some Iterative Methods for Linear Complementarity Problems}, journal = {SIAM Journal on Optimization}, year = {1996}, volume = {6}, pages = {326--341} } @Article{ kanzow:inexact, author = {C. Kanzow}, title = {An Inexact {QP}--based method for nonlinear complementarity problems}, journal = {Numerische Mathematik, forthcoming}, year = {1999} } @Article{ kanzow:noninterior, author = {C. Kanzow}, title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, journal = {SIAM Journal on Matrix Analysis and Applications}, volume = {17}, pages = {851--868}, year = {1996} } @Article{ kanzow:nonlinear, author = {C. Kanzow}, title = {Nonlinear Complementarity as Unconstrained Optimization}, journal = {Journal of Optimization Theory and Applications}, year = {1996}, volume = {88}, pages = {139--155} } @TechReport{ kanzow:semismooth, author = {C. Kanzow}, title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity Problems}, institution = {Institute of Applied Mathematics, University of Hamburg}, year = {1997}, type = {Preprint}, address = {Hamburg, Germany} } @TechReport{ kanzow:tools, annote = {This should be replaced by kanzow:noninterior}, author = {C. Kanzow}, title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, institution = {Institute of Applied Mathematics, University of Hamburg}, year = {1994}, address = {Germany} } @Article{ kaplan.meier:nonparametric, author = {E. L. Kaplan and P. Meier}, title = {Nonparametric Estimation from Incomplete Observations}, journal = {J. Am. Stat. Assoc.}, year = {1958}, volume = {53}, pages = {457--481} } @Article{ karamardian:complementarity, author = {S. Karamardian}, title = {The Complementarity Problem}, journal = {Mathematical Programming}, year = {1972}, volume = {2}, pages = {107--129} } @Article{ karamardian:complementarity*1, author = {S. Karamardian}, title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, journal = {Journal of Optimization Theory and Applications}, year = {1976}, volume = {18}, pages = {445--454} } @Article{ karamardian:generalized, author = {S. Karamardian}, title = {Generalized Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, year = {1971}, volume = {8}, pages = {161--167} } @Article{ karmarkar.karp.ea:probabilistic, author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, title = {Probabilistic Analysis of Optimum Partitioning}, journal = {Journal of Applied Probability}, year = {1986}, volume = {23}, pages = {626--645} } @Article{ karmarkar:polynomial, author = {N. Karmarkar}, title = {A New Polynomial Time Algorithm for Linear Programming}, journal = {Combinatorica}, year = {1984}, volume = {4}, pages = {373--395} } @Unpublished{ karp:probabilistic, author = {R. M. Karp}, title = {Probabilistic Analysis of Algorithms}, note = {(Lecture Notes)} } @InCollection{ karp:reducibility, author = {R. M. Karp}, title = {Reducibility among Combinatorial Problems}, booktitle = {Complexity of Computer Computations}, year = {1972}, editor = {R. E. Miller and J. W. Thatcher}, publisher = {Plenum Press}, address = {New York}, pages = {85--103} } @MastersThesis{ karush:minima, author = {W. Karush}, title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, year = {1939}, school = {Department of Mathematics, University of Chicago} } @TechReport{ karypis.kumar:metis, author = {G. Karypis and V. Kumar}, title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, Version 2.0}, institution = {University of Minnesota, Department of Computer Science}, type = {Technical Report}, address = {Minnesota}, year = {1995} } @TechReport{ karypis.kumar:multilevel, author = {G. Karypis and V. Kumar}, title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, institution = {University of Minnesota, Department of Computer Science}, type = {Technical Report}, number = {95-064}, address = {Minnesota}, year = {1995} } @Article{ katukani:generalization, author = {S. Katukani}, title = {A Generalization of {B}rouwer's Fixed Point Theorem}, journal = {Duke Mathematical Journal}, year = {1941}, volume = {8}, pages = {457--459} } @Article{ keifer.wolfowitz:stochastic, author = {J. Keifer and J. Wolfowitz}, title = {Stochastic Estimation of the Maximum of a Regression Function}, journal = {Annals of Mathematical Statistics}, year = {1952}, volume = {23}, pages = {462--466} } @InCollection{ kellog.li.ea:method, author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, booktitle = {Computing Fixed Points with Applications}, year = {1977}, editor = {S. Karamardian}, publisher = {Academic Press}, pages = {133--147} } @Book{ kennington.helgason:algorithms, author = {J. L. Kennington and R. V. Helgason}, title = {Algorithms for Network Programming}, year = {1980}, publisher = {John Wiley \& Sons}, address = {New York} } @Article{ kernighan.lin:efficient, author = {B. W. Kernighan and S. Lin}, title = {An Efficient Heuristic Procedure for Partitioning Graphs}, journal = {The Bell System Technical Journal}, pages = {291--307}, volume = {29}, year = {1970} } @Article{ khachian:polynomial, author = {L. G. Khachian}, title = {A Polynomial Algorithm for Linear Programming}, journal = {Soviet Mathematics Doklady}, year = {1979}, volume = {20}, pages = {191--194} } @Article{ khobotov:modification, author = {E. N. Khobotov}, title = {A Modification of the Extragradient Method for the Solution of Variational Inequalities and some Optimization Problems}, journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, year = {1987}, volume = {27}, pages = {1462--1473} } @Book{ khuri.cornell:response, author = {A. I. Khuri and J. A. Cornell}, title = {Response Surfaces: Designs and Analyses}, publisher = {Marcel Dekker}, year = {1987}, address = {New York} } @Article{ kibardin:decomposition, author = {V. M. Kibardin}, title = {Decomposition into Functions in the Minimization Problems}, journal = {Automation and Remote Control}, year = {1980}, volume = {40}, pages = {1311--1323} } @TechReport{ king:sposl, author = {A. J. King}, title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, institution = {IBM T.J. Watson Research Center}, year = {1994}, number = {RC 19757}, address = {Yorktown Heights, New York} } @Article{ kirkpatrick.gelatt.ea:optimization, author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, title = {Optimization by Simulated Annealing}, journal = {Science}, year = {1983}, volume = {220}, pages = {671--680} } @Book{ kiwiel:methods, author = {K. C. Kiwiel}, title = {Methods of Descent for Nondifferentiable Optimization}, year = {1985}, publisher = {Springer-Verlag}, address = {Berlin}, series = {Lecture Notes in Mathematics}, number = {1133} } @Article{ kiwiel:twice, author = {K. C. Kiwiel}, title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, journal = {Journal of Optimization Theory and Applications}, year = {1996}, volume = {88}, pages = {233--236} } @Article{ klarbring.bjorkman:mathematical, author = {A. Klarbring and G. Bj{\"{o}}rkman}, title = {A mathematical programming approach to contact problems with friction and varying contact surface}, journal = {Computers \& Structures}, volume = {30}, year = {1988}, pages = {1185--1198} } @Article{ klarbring.bjorkman:solution, author = {A. Klarbring and G. Bj{\"{o}}rkman}, title = {Solution of large displacement contact problems with friction using {N}ewton's method for generalized equations}, journal = {International Journal for Numerical Methods in Engineering}, volume = {34}, year = {1992}, pages = {249--269} } @Article{ klarbring.pang:existence, author = {A. Klarbring and J. S. Pang}, title = {Existence of solution to discrete semicoercive frictional contact problems}, journal = {{SIAM} Journal on Optimization, under review}, year = {1996} } @Article{ klarbring:discrete, author = {A. Klarbring}, title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact (Stability, Uniqueness and Variational Principles)}, journal = {International Journal on Solids and Structures}, volume = {24}, pages = {459--479}, year = {1988} } @TechReport{ klarbring:large, author = {A. Klarbring}, title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element Discretization}, number = {LiTH-IKP-R-798}, institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, address = {Link{\"o}ping}, year = {1994} } @Article{ klarbring:mathematical, author = {A. Klarbring}, title = {A mathematical programming approach to three dimensional contact problems with friction}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {58}, year = {1986}, pages = {175--200} } @InCollection{ klarbring:mathematical*1, author = {A. Klarbring}, title = {Mathematical programming and augmented {L}agrangian methods for frictional contact problems}, editor = {A. Curnier}, booktitle = {Proceedings Contact Mechanics International Symposium}, publisher = {Presse Polytechniques et Universitaires Romandes}, address = {Lausanne}, year = {1992}, pages = {409--422} } @InCollection{ klarbring:mathematical*2, author = {A. Klarbring}, title = {Mathematical programming in contact problems}, editors = {M. H. Aliabadi and C. A. Brebbia}, booktitle = {Computational Methods for Contact Problems}, publisher = {Computational Mechanics Publications}, address = {Southampton}, year = {1993}, pages = {233--264} } @Article{ klarbring:quadratic, author = {A. Klarbring}, title = {A quadratic program in frictionless contact problems}, journal = {International Journal of Engineering Science}, volume = {24}, pages = {1207--1217}, year = {1986} } @InCollection{ klee.minty:how, author = {V. Klee and G. J. Minty}, title = {How Good is the Simplex Algorithm?}, booktitle = {Inequalities--III}, year = {1972}, publisher = {Academic Press}, pages = {159--175} } @Article{ kleywegt.shapiro:sample, author = {A. Kleywegt and A. Shapiro}, title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, journal = {Stochastic Programming E-Print Series}, year = {1999}, note = {Available from dochost.rz.hu-berlin.de/speps} } @Book{ knuth:art, author = {D. E. Knuth}, title = {The Art of Computer Programming}, publisher = {Addison-Wesley Longman Inc.}, address = {Reading, Massachusetts}, year = {1998}, edition = {Third}, volume = {2} } @InProceedings{ kocvara.outrata:nonsmooth, author = {M. Ko\v{c}vara and J. V. Outrata}, title = {A nonsmooth approach to optimization problems with equilibrium constraints}, crossref = {ferris.pang:complementarity}, pages = {148--164} } @Article{ kocvara.outrata:optimization, author = {M. Ko\v{c}vara and J. V. Outrata}, title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, volume = {15}, journal = {Numerical Fucntional Analysis and Optimization}, year = {1994}, pages = {869--887} } @InCollection{ kocvara.outrata:solution, author = {M. Ko\v{c}vara and J. V. Outrata}, title = {On the solution of optimum design problems with variational inequalities}, editors = {D. Z. Du and L. Qi and R. Womersley}, booktitle = {Recent Advances in Nonsmooth Optimization}, publisher = {World Scientific Publishers}, address = {Singapore}, year = {1995}, pages = {172--192} } @Article{ kojima.hirabayashi:homotopy, author = {M. Kojima and R. Hirabayashi}, title = {Continuous deformation of nonlinear programs}, journal = {Mathematical Programming Study}, editor = {A.~V. Fiacco}, publisher = {North--Holland}, address = {Amsterdam}, year = {1984}, volume = {21}, pages = {150--198} } @Article{ kojima.megiddo.ea:homotopy, author = {M. Kojima and N. Megiddo and T. Noma}, title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, journal = {Mathematics of Operations Research}, year = {1991}, volume = {16}, pages = {754--774} } @TechReport{ kojima.megiddo.ea:primal-dual, author = {M. Kojima and N. Megiddo and S. Mizuno}, title = {A primal-dual exterior point algorithm for linear programming}, institution = {IBM Alamaden Research Center}, year = {1991}, number = {RJ 8500}, address = {San Jose, California} } @Book{ kojima.megiddo.ea:unified, author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity Problems}, year = {1991}, publisher = {Springer-Verlag}, address = {Berlin}, volume = {538}, series = {Lecture Notes in Computer Science} } @Article{ kojima.mizuno.ea:continuation, author = {M. Kojima and S. Mizuno and T. Noma}, title = {A New Continuation Method for Complementarity Problems with Uniform {P}-function}, journal = {Mathematical Programming}, year = {1989}, volume = {43}, pages = {107--113} } @TechReport{ kojima.mizuno.ea:infeasible, author = {M. Kojima and S. Mizuno and M. Todd}, title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear programming}, institution = {School of Operations Research and Industrial Engineering, Cornell University}, year = {1992}, number = {1023}, address = {Ithaca, New York}, month = aug } @Article{ kojima.mizuno.ea:onl, author = {M. Kojima and S. Mizuno and A. Yoshise}, title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear complementarity problems}, journal = {Mathematical Programming}, year = {1991}, volume = {50}, pages = {331--342} } @Article{ kojima.mizuno.ea:polynomial-time, author = {M. Kojima and S. Mizuno and A. Yoshise}, title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, journal = {Mathematical Programming}, year = {1989}, volume = {44}, pages = {1--20} } @Article{ kojima.noma.ea:global, author = {M. Kojima and T. Noma and A. Yoshise}, title = {Global Convergence in Infeasible Interior--Point Algorithms}, journal = {Mathematical Programming}, volume = {65}, pages = {43--72}, year = {1994} } @Article{ kojima.shindo.ea:interior-point, author = {M. Kojima and S. Shindo and S. Hara}, title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity Problem in Symmetric Matrices}, journal = {SIAM Journal on Optimization}, volume = {7}, pages = {86--125} } @Article{ kojima.shindo:extensions, author = {M. Kojima and S. Shindo}, title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ Equations}, journal = {Journal of Operations Research Society of Japan}, year = {1986}, volume = {29}, pages = {352--374} } @Article{ kojima:computational, author = {M. Kojima}, title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, journal = {Keio Engineering Reports}, year = {1974}, volume = {27}, pages = {1--41} } @Article{ kojima:recent, author = {M. Kojima}, title = {Recent advances in mathematical programming. {X}. Computation of fixed points by continuation methods}, journal = {Systems and Control}, year = {1981}, volume = {25}, pages = {421--430} } @Article{ kolesar:branch, author = {P. J. Kolesar}, title = {A Branch and Bound Algorithm for the Knapsack Problem}, journal = {Management Science}, year = {1967}, volume = {13}, pages = {723--735} } @Book{ kolman.beck:elementary, author = {B. Kolman and R. E. Beck}, title = {Elementary Linear Programming with Applications}, year = {1980}, publisher = {Academic Press} } @Book{ koopmans:activity, editor = {T. C. Koopmans}, title = {Activity Analysis of Production and Allocation}, publisher = {John Wiley}, address = {New York}, year = {1951} } @Article{ korpelevich:extragradient, author = {G. M. Korpelevich}, title = {The Extragradient Method for Finding Saddle Points and Other Problems}, journal = {Matecon}, year = {1976}, volume = {12}, pages = {747--756} } @Article{ kortanek.shi:convergence, author = {K. O. Kortanek and M. Shi}, title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid Algorithm}, journal = {European Journal of Operational Research}, year = {1987}, volume = {32}, pages = {47--61} } @TechReport{ kortanek.shi:remarks, author = {K. O. Kortanek and M. Shi}, title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming Hybrid Algorithm 1985-6'}, institution = {College of Business Administration, University of Iowa}, year = {1987}, address = {Iowa City}, number = {87--1}, type = {Working Paper} } @TechReport{ kortanek:vector-supercomputer, author = {K. O. Kortanek}, title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, institution = {College of Business Administration, University of Iowa}, year = {1987}, address = {Iowa City}, number = {87--2}, type = {Working Paper} } @Article{ kostreva:block, author = {M. M. Kostreva}, title = {Block Pivot Methods for Solving the Complementarity Problem}, journal = {Linear Algebra and Its Applications}, volume = {21}, pages = {207--215}, year = {1978} } @Article{ kostreva:elasto-hydrodynamic, author = {M. M. Kostreva}, title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, journal = {International Journal for Numerical Methods in Fluids}, year = {1984}, volume = {4}, pages = {377--397} } @Article{ kostreva:recent, author = {M. M. Kostreva}, title = {Recent Results on Complementarity Models for Engineering and Economics}, journal = {Infor, Journal of the Canadian {OR} Society}, year = {1990}, volume = {28}, pages = {324--334} } @Article{ kotiah.steinberg:occurrences, author = {T. C. T. Kotiah and D. I. Steinberg}, title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear Programming Models}, journal = {Communications of the ACM}, volume = {20}, year = {1977}, pages = {107--112} } @Article{ kotiah.steinberg:possibility, author = {T. C. T. Kotiah and D. I. Steinberg}, title = {On the Possibility of Cycling with the Simplex Method}, journal = {Operations Research}, volume = {26}, year = {1978}, pages = {374--376} } @InCollection{ kuhn.tucker:nonlinear, author = {H. W. Kuhn and A. W. Tucker}, title = {Nonlinear Programming}, booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and Probability}, year = {1951}, editor = {J. Neyman}, publisher = {University of California Press}, address = {Berkeley and Los Angeles}, pages = {481--492} } @Article{ kummer:metric, author = {B. Kummer}, title = {Metric regularity: characterizations, nonsmooth variations, and successive approximation}, journal = {Journal of Mathematical Analysis and its Applications}, year = {}, optkey = {}, optvolume = {}, optnumber = {}, optpages = {}, optmonth = {}, optnote = {}, optannote = {} } @InCollection{ kummer:newtons, author = {B. Kummer}, title = {{N}ewton's Method for Non--Differentiable Functions}, booktitle = {Advances in Mathematical Optimization}, publisher = {Akademie--Verlag}, year = {1988}, editors = {J. Guddat et al.}, pages = {114--125}, address = {Berlin} } @Unpublished{ kuntsevich.kappel:solvopt, author = {A. Kuntsevich and F. Kappel}, title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, year = {1997}, note = {Institute for Mathematics, Karl-Franzens University of Graz}, url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} } @Book{ kushner.clark:stochastic, author = {H. J. Kushner and D. S. Clark}, title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, publisher = {Springer-Verlag}, year = {1978}, address = {New York} } @Article{ kutcher.burman.ea:histogram, author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, title = {Histogram reduction method for calculating complication probabilities for three-dimensional treatment planning evaluation}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1991}, optvolume = {21}, optpages = {137-146} } @Article{ kutcher.burman:calculation, author = {G. J. Kutcher and C. Burman}, title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue Irradiation: The Effective Volume Method}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1989}, volume = {16}, pages = {1623--1630} } @Article{ kwak.lee:complementarity, author = {B. M. Kwak and B. C. Lee.}, title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact Problem}, journal = {Computers and Structures}, volume = {18}, pages = {469--480}, year = {1988} } @Article{ kwak:complementarity, author = {B. M. Kwak}, title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, journal = {Journal of Applied Mechanics}, volume = {58}, pages = {134--140}, year = {1991} } @Article{ lagarias.reeds.ea:convergence, author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, journal = {SIAM Journal on Optimization}, year = {1998}, volume = {9}, pages = {112--147} } @Article{ lahaye:methode, author = {E. Lahaye}, title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations transcendantes}, journal = {C. R. Acad. Sci. Paris}, year = {1934}, volume = {198}, pages = {1840--1842} } @Article{ lahaye:solution, author = {E. Lahaye}, title = {Solution of Systems of Transcendental Equations}, journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, year = {1948}, volume = {5}, pages = {805--822} } @Article{ lahenbruch.mickey:estimation, author = {P. A. Lahenbruch and R. M. Mickey}, title = {Estimation of Error Rates in Discriminant Analysis}, journal = {Technometrics}, year = {1968}, volume = {10}, pages = {1--11} } @Article{ lakshminarayan.lakshmanan.ea:optimal, author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, journal = {Operations Research}, year = {1978}, volume = {26}, pages = {1079--1082} } @Article{ land.doig:automatic, author = {A. H. Land and A. G. Doig}, title = {An Automatic Method for Solving Discrete Programming Problems}, journal = {Econometrica}, volume = {28}, year = {1960}, pages = {497-520} } @Article{ langer.morrill:comparison, author = {M. Langer and S. Morrill}, title = {A comparison of mixed integer programming and fast simulated annealing for optimized beam weights in radiation therapy}, journal = {Medical Physics}, year = {1996}, volume = {23}, number = {6}, pages = {957--964} } @Article{ larsson.patriksson:class, author = {T. Larsson and M. Patriksson}, title = {A Class of Gap Functions for Variational Inequalities}, journal = {Mathematical Programming}, year = {1994}, volume = {64}, pages = {53--79} } @Article{ lasdon.waren.ea:solving, author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive Linear Programming Algorithms}, journal = {ACM SIGMAP Bulletin}, year = {1979}, volume = {27}, pages = {9--15} } @TechReport{ lawler.lenstra.ea:sequencing, author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, title = {Sequencing and Scheduling: Algorithms and Complexity}, institution = {Centre for Mathematics and Computer Science}, year = {1989}, address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, number = {BS--R89xx} } @Article{ lawler:fast, author = {E. L. Lawler}, title = {Fast Approximations Algorithms for Knapsack Problems}, journal = {Mathematics of Operations Research}, year = {1979}, volume = {4}, pages = {339--356} } @Book{ lawless:statistical, author = {J. F. Lawless}, title = {Statistical Models and Methods for Lifetime Data}, year = {1982}, publisher = {John Wiley and Sons}, address = {New York, NY} } @Article{ lawrence.spingarn:fixed, author = {J. Lawrence and J. E. Spingarn}, title = {On fixed points of non-expansive piecewise isometric mappings}, journal = {Proceedings of the London Mathematical Society}, year = {1987}, volume = {55}, number = {3}, pages = {605--624} } @Article{ leavitt.martin.ea:dynamic, author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, title = {Dynamic wedge field techniques through computer-controlled collimator motion and dose delivery}, journal = {Medical Physics}, year = {1990}, volume = {17}, number = {1}, pages = {87--92} } @Article{ leblanc.morlok.ea:efficient, author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment Problem}, journal = {Transportation Research}, volume = {9}, year = {1975}, pages = {309--318} } @Article{ lee:computational, author = {S. S. Lee}, title = {A computational method for frictional contact problem using finite element method}, journal = {International Journal for Numerical Methods in Engineering}, volume = {37}, year = {1994}, pages = {217--228} } @PhDThesis{ lee:military, author = {D. K. Lee}, title = {Military Force Planning Problems Under Uncertainty}, school = {University of Wisconsin -- Madison}, year = {1996}, address = {Madison, Wisconsin} } @Article{ leibel.kutcher.ea:improved, author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of the Nasopharynx}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1991}, volume = {20}, pages = {823--833} } @Article{ lee.gallagher.ea:treatment, author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two Computational Approaches and Experiments with Permanent Prostate Implant Planning}, journal = {Physics in Medicine and Biology}, year = {1999}, volume = {44}, pages = {145--165} } @Article{ lemarechal.nemirovskii.ea:variants, author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, title = {New Variants of Bundle Methods}, year = {1995}, journal = {Mathematical Programming}, volume = {69}, pages = {111--147} } @InCollection{ lemarechal.strodiot.ea:bundle, author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, title = {On a Bundle Algorithm for Nonsmooth Optimization}, booktitle = {Nonlinear Programming}, year = {1981}, editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, publisher = {Academic Press}, pages = {245--282}, volume = {4} } @Article{ lemke.howson:equilibrium, author = {C. E. Lemke and J. T. Howson}, title = {Equilibrium Points of Bimatrix Games}, journal = {SIAM Journal on Applied Mathematics}, year = {1964}, volume = {12}, pages = {413--423} } @Article{ lemke:bimatrix, author = {C. E. Lemke}, title = {Bimatrix Equilibrium Points and Mathematical Programming}, journal = {Management Science}, year = {1965}, volume = {11}, pages = {681--689} } @InCollection{ lemke:complementary, author = {C. E. Lemke}, title = {On Complementary Pivot Theory}, booktitle = {Mathematics of the Decision Sciences: Part 1}, publisher = {American Mathematical Society}, year = {1968}, editor = {G. B. Dantzig and A. F. Veinott}, volume = {11}, series = {Lectures in Applied Mathematics}, address = {Providence}, pages = {95--114} } @Article{ levenberg:method, author = {K. Levenberg}, title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, journal = {Quarterly Applied Mathematics}, year = {1944}, volume = {2}, pages = {164--168} } @Article{ levitin.polyak:constrained, author = {E. S. Levitin and B. T. Polyak}, title = {Constrained minimization methods}, journal = {Computational Mathematics and Mathematical Physics}, year = {1968}, volume = {6}, pages = {1--50}, note = {Translated from Russian} } @Article{ li.swetis:linear, author = {W. Li and J. J. Swetits}, title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, journal = {SIAM Journal on Optimization}, volume = {8}, pages = {457-475}, year = {1998} } @TechReport{ li:error, author = {W. Li}, title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, institution = {Department of Mathematics and Statistics, Old Dominion University}, year = {1993}, address = {Norfolk, VA 23529}, number = {TR93-1}, note = {SIAM Journal on Control and Optimization, to appear} } @TechReport{ li:linearly, author = {W. Li}, title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex Quadratic Splines}, institution = {Department of Mathematics and Statistics, Old Dominion University}, year = {1993}, address = {Norfolk, VA 23529}, number = {TR93-3}, note = {Journal of Optimization Theory and Applications, to appear} } @InProceedings{ li:merit, author = {W. Li}, title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity Problems}, crossref = {ferris.pang:complementarity} } @Article{ li:remarks, author = {W. Li}, title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear Complementarity Problem}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, pages = {155--163} } @TechReport{ li:sharp, author = {W. Li}, title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, institution = {Department of Mathematics and Statistics, Old Dominion University}, year = {1991}, address = {Norfolk, VA 23529}, number = {TR91-13}, note = {SIAM Journal on Control and Optimization, to appear} } @Article{ lin.kernighan:efficient, author = {S. Lin and B. W. Kernighan}, title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, journal = {Operations Research}, year = {1973}, volume = {21}, pages = {498--516} } @Article{ lin.pang:iterative, author = {Y. Y. Lin and J. S. Pang}, title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, journal = {SIAM Journal on Control and Optimization}, year = {1987}, volume = {25}, pages = {383--411} } @Unpublished{ linderoth:branch, author = {J. Linderoth}, title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, institution = {Argonne National Laboratories}, year = {2000}, note = {Working Paper} } @Article{ lions.stampacchia:variational, author = {J. L. Lions and G. Stampacchia}, title = {Variational Inequalities}, journal = {Communications on Pure and Applied Math}, year = {1967}, volume = {20}, pages = {493--19} } @Article{ lions.mercier:splitting, author = {P.--L. Lions and B. Mercier}, title = {Splitting Methods for the Sum of Two Nonlinear Operators}, journal = {SIAM Journal on Numerical Analysis}, year = {1979}, volume = {16}, pages = {964--979} } @Article{ lions:methode, author = {P.--L. Lions}, title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, journal = {Israel Journal of Mathematics}, year = {1978}, volume = {31}, number = {2}, pages = {204--208} } @InProceedings{ litzkow.livny.ea:condor, author = {M. J. Litzkow and M. Livny and M. W. Mutka}, title = {Condor: {A} Hunter of Idle Workstations}, booktitle = {Proceedings of the 8th International Conference on Distributed Computing Systems}, year = {1988}, pages = {104--111}, month = jun } @Article{ liu.nocedal:limited, author = {D. C. Liu and J. Nocedal}, title = {On the Limited Memory Method for Large Scale Optimization}, journal = {Mathematical Programming}, year = {1989}, volume = {45}, pages = {503--528} } @InBook{ livny.raman:high, author = {M. Livny and R. Raman}, title = {The Grid: Blueprint for a Future Computing Infrastructure}, chapter = {High Throughput Resource Management}, publisher = {Morgan Kaufmann Publishers}, year = {1999}, pages = {311--337} } @Article{ llacer:inverse, author = {J. Llacer}, title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood Method}, journal = {Medical Physics}, year = {1997}, volume = {24}, number = {11}, pages = {1751--1764} } @Book{ lojasiewicz:ensembles, author = {M. S. Lojasiewicz}, title = {Ensembles semi-analytiques}, publisher = {Institut des Hautes Etudes Scientifiques}, year = {1964}, address = {Bures-sur-Yvette} } @Article{ lootsma:logarithmic, author = {F. A. Lootsma}, title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, journal = {Phillips Research Reports}, year = {1967}, volume = {22}, pages = {329--344} } @InCollection{ lootsma:survey, author = {F. A. Lootsma}, title = {A Survey of Methods for Solving Constrained Minimization Problems via Unconstrained Minimization}, booktitle = {Numerical Methods for Nonlinear Optimization}, year = {1972}, editor = {F. A. Lootsma}, publisher = {Academic Press}, address = {London} } @TechReport{ lopezdesilanes.markusen.ea:anti-competitive, author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in Regional Trade Blocks}, institution = {National Bureau of Economic Research, Inc.}, year = {1993}, number = {4512}, address = {Cambridge, Massechusetts} } @InCollection{ lopezdesilanes.markusen.ea:auto, author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, title = {The auto industry and the {N}orth {A}merican free-trade agreement}, year = {1994}, booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, publisher = {Cambridge University Press}, editor = {C. Shields and J. Francois} } @Article{ lopezdesilanes.markusen.ea:complementarity, author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, title = {Complementarity and Increasing Returns in Intermediate Inputs}, journal = {Journal of Development Economics}, year = {1994}, volume = {45}, pages = {133--151} } @Article{ lopezdesilanes.markusen.ea:trade, author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, title = {Trade Policy Subtleties with Multinational Firms}, journal = {European Economic Review}, year = {1996} } @Article{ lotstedt:coulomb, author = {P. L{\"{o}}tstedt}, title = {Coulomb friction in two-dimensional rigid body systems}, journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, volume = {61}, year = {1981}, pages = {605--615} } @Article{ lotstedt:mechanical, author = {P. L{\"{o}}tstedt}, title = {Mechanical systems of rigid bodies subject to unilateral constraints}, journal = {SIAM Journal on Applied Mathematics}, volume = {42}, year = {1982}, pages = {281--296} } @Book{ luenberger:linear, author = {D. G. Luenberger}, title = {Linear and Nonlinear Programming}, year = {1984}, publisher = {Addison-Wesley}, edition = {Second} } @Book{ luenberger:optimization, author = {D. G. Luenberger}, title = {Optimization by Vector Space Methods}, year = {1969}, publisher = {John Wiley \& Sons}, address = {New York} } @Article{ lundy.mees:convergence, author = {M. Lundy and A. Mees}, title = {Convergence of an Annealing Algorithm}, journal = {Mathematical Programming}, year = {1986}, volume = {34}, pages = {111--124} } @Article{ luo.luo:extension, author = {X.-D. Luo and Z.-Q. Luo}, title = {Extension of Hoffman's Error Bound to Polynomial Systems}, journal = {SIAM Journal on Optimization}, year = {1994}, volume = {4}, pages = {383--392} } @Article{ luo.mangasarian.ea:error, author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, title = {New Error Bounds for the Linear Complementarity Problem}, journal = {Mathematics of Operations Research}, year = {1994}, pages = {880--892}, volume = {19} } @Article{ luo.pang.ea:exact, author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with Equilibrium Constraints}, journal = {Mathematical Programming}, volume = {75}, pages = {19--76}, year = {1996} } @Book{ luo.pang.ea:mathematical, author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, title = {Mathematical Programs with Equilibrium Constraints}, publisher = {Cambridge University Press}, year = {1996} } @Article{ luo.pang:error, author = {Z.-Q. Luo and J. S. Pang}, title = {Error Bounds for Analytic Systems and their Applications}, journal = {Mathematical Programming}, year = {1994}, volume = {67}, pages = {1--28} } @Article{ luo.shu.ea:optimizing, author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, title = {Optimizing computerized treatment planning for the Gamma Knife by source culling}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1999}, volume = {45}, number = {5}, pages = {1339--1346} } @InProceedings{ luo.tseng:class, author = {Z.-Q. Luo and P. Tseng}, title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, crossref = {ferris.pang:complementarity}, pages = {204--225} } @Article{ luo.tseng:convergence, author = {Z.-Q. Luo and P. Tseng}, title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable Minimization}, journal = {Journal of Optimization Theory and Applications}, year = {1992}, volume = {72}, pages = {7--35} } @Article{ luo.tseng:convergence*1, author = {Z.-Q. Luo and P. Tseng}, title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone Linear Complementarity Problem}, journal = {SIAM Journal on Control and Optimization}, year = {1991}, volume = {29}, pages = {1037--1060} } @Article{ luo.tseng:convergence*2, author = {Z.-Q. Luo and P. Tseng}, title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, journal = {Mathematics of Operations Research}, year = {1993}, volume = {18}, pages = {846--867} } @Article{ luo.tseng:error, author = {Z.--Q. Luo and P. Tseng}, title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the Affine Variational Inequality Problem}, journal = {SIAM Journal on Optimization}, year = {1992}, volume = {2}, pages = {43--54} } @Article{ luo.tseng:error*1, author = {Z.-Q. Luo and P. Tseng}, title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization Over a Polyhedral Set}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, pages = {43--59} } @Article{ luo.tseng:error*2, author = {Z.-Q. Luo and P. Tseng}, title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General Approach}, journal = {Annals of Operations Research}, year = {1993}, volume = {46}, pages = {157--178} } @Article{ luo.tseng:global, author = {Z.-Q. Luo and P. Tseng}, title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality Problems}, journal = {Operations Research Letters}, year = {1992}, volume = {11}, pages = {159--165} } @Article{ luo.tseng:linear, author = {Z.-Q. Luo and P. Tseng}, title = {On the linear convergence of descent methods for convex essentially smooth minimization}, journal = {SIAM Journal on Control and Optimization}, year = {1992}, volume = {30}, pages = {408--425} } @TechReport{ luo:convergence, author = {Z.-Q. Luo}, title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex Quadratic Programs}, institution = {Communications Research Laboratory, McMaster University}, year = {1992}, address = {Hamilton, Ontario} } @Article{ lustig.marsten.ea:computational, author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, title = {Computational Experience with a Primal-Dual Interior Point Method for Linear Programming}, journal = {Linear Algebra and Its Applications}, year = {1991}, volume = {152}, pages = {191--222} } @Article{ lustig.marsten.ea:implementing, author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear programming}, journal = {SIAM Journal on Optimization}, year = {1992}, volume = {2}, pages = {435--449} } @Article{ lustig.marsten.ea:interior-point, author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, journal = {ORSA Journal on Computing}, year = {1994}, volume = {6}, number = {1}, pages = {1--38} } @Article{ lyman.wolbarst:optimization, author = {J. T. Lyman and A. B. Wolbarst}, title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction Algorithm}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1989}, volume = {17}, pages = {433--436} } @Article{ mackie.holmes.ea:tomotherapy*1, author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and J. Yang and B. Paliwal and T. Kinsella}, title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, journal = {Medical Physics}, year = {1993}, volume = {20}, number = {6}, pages = {1709--1719} } @Article{ mackie.holmes.ea:tomotherapy*2, author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, journal = {Int. J. of Imaging Systems and Technology}, year = {1995}, volume = {6}, pages = {43--55} } @Article{ mackie.scrimger.ea:convolution, author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, title = {A convolution method of calculating dose from 15 Me{V} x-rays}, journal = {Medical Physics}, year = {1985}, volume = {12}, pages = {188--196} } @Article{ mackinnon:technique, author = {James G. Mac{K}innon}, title = {A Technique for the Solution of Spatial Equilibrium Models}, journal = {Journal of Regional Science}, year = {1976}, volume = {16}, pages = {293--307} } @PhDThesis{ madsen:minimization, author = {K. Madsen}, title = {Minimization of Nonlinear Approximation Functions}, year = {1985}, address = {Lyngby, Denmark}, school = {Institute of Numerical Analysis, Technical University of Denmark}, annote = {Dissertation} } @Book{ magill.quinzii:theory, author = {M. Magill and M. Quinzii}, title = {Theory of Incomplete Markets}, publisher = {MIT Press}, year = {1996} } @InCollection{ magnanti:models, author = {T. L. Magnanti}, title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, booktitle = {Transportation Planning Models}, year = {1984}, editor = {M. Florian}, publisher = {North Holland}, pages = {153--186} } @InCollection{ maguregui:modified, author = {J. Maguregui}, title = {A modified {N}ewton algorithm for functions over convex sets}, crossref = {mangasarian.meyer.ea:nonlinear*3}, pages = {461--473} } @PhDThesis{ maguregui:regular, author = {J. Maguregui}, title = {Regular Multivalued Functions and Algorithmic Applications}, year = {1977}, address = {Madison, Wisconsin}, school = {Computer Sciences Department, University of Wisconsin} } @Article{ mahey.oualibouch.ea:proximal, author = {P. Mahey and S. Oualibouch and D. T. Pham}, title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, journal = {SIAM Journal on Optimization}, year = {1995}, volume = {5}, pages = {454--466} } @Article{ mahey.pham:partial, author = {P. Mahey and D. T. Pham}, title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, year = {1993}, volume = {27}, pages = {375--392} } @InCollection{ maier.novati:shakedown, author = {G. Maier and G. Novati}, title = {A shakedown and bounding theory allowing for nonlinear hardening and second order geometric effects with reference to discrete structural models}, editors = {J. A. K{\"{o}}nig and M. Kleiber}, booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, publisher = {Pineridge Press}, address = {Swansea}, year = {1990}, pages = {451--471} } @Article{ maier:incremental, author = {G. Maier}, title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical Instabilizing Effects}, journal = {International Journal of Solids and Structures}, volume = {7}, year = {1971}, pages = {345--372} } @InCollection{ maier:inverse, author = {G. Maier}, title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, booktitle = {Serie VIII}, publisher = {Academia Nazionale dei Lincei}, year = {1981}, volume = {LXX}, pages = {203--209} } @Article{ maier:matrix, author = {G. Maier}, title = {A matrix structural theory of piecewise linear elastoplasticity with interacting yield planes}, journal = {Meccanica}, volume = {5}, year = {1970}, pages = {54--66} } @Article{ maier:quadratic, author = {G. Maier}, title = {A quadratic programming approach for certain classes of nonlinear structural problems}, journal = {Meccanica}, volume = {3}, year = {1968}, pages = {121--130} } @Book{ manber:introduction, author = {U. Manber}, title = {Introduction to Algorithms: {A} Creative Approach}, year = {1989}, publisher = {Addison-Wesley} } @Article{ mangasarian.deleone:error, author = {O. L. Mangasarian and R. {De~Leone}}, title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent Iterative Schemes for the Least 2--norm Solution of Linear Programs}, journal = {Applied Mathematics and Optimization}, year = {1988}, volume = {17}, pages = {1--14} } @Article{ mangasarian.deleone:parallel, author = {O. L. Mangasarian and R. {De~Leone}}, title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity Problems and Linear Programs}, journal = {Journal of Optimization Theory and Applications}, year = {1987}, volume = {54}, pages = {437--446} } @Article{ mangasarian.fromovitz:fritz, author = {O. L. Mangasarian and S. Fromovitz}, title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality and inequality constraints}, journal = {Journal of Mathematical Analysis and its Applications}, year = {1967}, volume = {17}, pages = {37--47} } @Article{ mangasarian.mclinden:simple, author = {O. L. Mangasarian and L. McLinden}, title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex Programs}, journal = {Mathematical Programming}, year = {1985}, volume = {32}, pages = {32--40} } @Article{ mangasarian.meyer:nonlinear, author = {O. L. Mangasarian and R. R. Meyer}, title = {Nonlinear Perturbation of Linear Programs}, journal = {SIAM Journal on Control and Optimization}, year = {1979}, volume = {17}, pages = {745--752} } @TechReport{ mangasarian.musicant:active, author = {O. L. Mangasarian and David R. Musicant}, title = {Active Set Support Vector Machine Classification}, institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, year = {2000}, number = {00-04}, address = {Madison, Wisconsin} } @TechReport{ mangasarian.musicant:lagrangian, author = {O. L. Mangasarian and D. R. Musicant}, title = {Lagrangian Support Vector Machines}, institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, year = {2000}, number = {00-06}, address = {Madison, Wisconsin} } @TechReport{ mangasarian.musicant:robust, author = {O. L. Mangasarian and David R. Musicant}, title = {Robust Linear and Support Vector Regression}, institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, year = {1999}, number = {99-09}, address = {Madison, Wisconsin} } @Article{ mangasarian.musicant:successive, author = {O. L. Mangasarian and David R. Musicant}, title = {Successive Overrelaxation for Support Vector Machines}, journal = {IEEE Transactions on Neural Networks}, volume = {10}, year = {1999}, pages = {1032-1037} } @Article{ mangasarian.pang:exact, author = {O. L. Mangasarian and J. S. Pang}, title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity Constraints}, journal = {Optimization}, year = {1997}, volume = {42}, pages = {1--8} } @Article{ mangasarian.pang:extended, author = {O. L. Mangasarian and J. S. Pang}, title = {The Extended Linear Complementarity Problem}, journal = {SIAM Journal on Matrix Analysis and Applications}, year = {1994}, volume = {16} } @Article{ mangasarian.ren:error, author = {O. L. Mangasarian and J. Ren}, title = {New error bounds for the nonlinear complementarity problem}, year = {1994}, volume = {1}, pages = {49--56}, journal = {Communications on Applied Nonlinear Analysis} } @Article{ mangasarian.ren:improved, author = {O. L. Mangasarian and J. Ren}, title = {New Improved Error Bounds for the Linear Complementarity Problem}, year = {1994}, volume = {66}, journal = {Mathematical Programming}, pages = {241--255} } @InProceedings{ mangasarian.setiono.ea:pattern, crossref = {coleman.li:large-scale}, author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, title = {Pattern Recognition via Linear Programming: Theory and Application to Medical Diagnosis}, pages = {22--31} } @Article{ mangasarian.shiau:error, author = {O. L. Mangasarian and T.--H. Shiau}, title = {Error Bounds for Monotone Linear Complementarity Problems}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {81--89} } @Article{ mangasarian.shiau:lipschitz, author = {O. L. Mangasarian and T.--H. Shiau}, title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and Complementarity Problems}, journal = {SIAM Journal on Control and Optimization}, year = {1987}, volume = {25}, pages = {583--595} } @Article{ mangasarian.solodov:nonlinear, author = {O. L. Mangasarian and M. V. Solodov}, title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, journal = {Mathematical Programming}, year = {1993}, volume = {62}, pages = {277--298} } @Article{ mangasarian.solodov:serial, author = {O. L. Mangasarian and M. V. Solodov}, title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed Minimization}, year = {1994}, journal = {Optimization Methods and Software}, volume = {4}, pages = {103--116} } @Article{ mangasarian.street.ea:breast, author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, journal = {Operations Research}, year = {1995}, volume = {43}, pages = {570--577} } @Article{ mangasarian.wolberg:cancer, author = {O. L. Mangasarian and W. H. Wolberg}, title = {Cancer Diagnosis via Linear Programming}, journal = {SIAM News}, year = {1990}, volume = {23}, pages = {1 \& 18} } @InCollection{ mangasarian:applications, author = {O. L. Mangasarian}, title = {Some Applications of Penalty Functions in Mathematical Programming}, booktitle = {Optimization and Related Fields}, year = {1986}, editor = {R. Conti and E. De~Giorgi and F. Giannessi}, publisher = {Springer-Verlag}, address = {Heidelberg}, pages = {307--329}, note = {Lecture Notes in Mathematics 1190} } @Article{ mangasarian:characterization, author = {O. L. Mangasarian}, title = {Characterization of linear complementarity problems as linear programs}, journal = {Mathematical Programming Study}, year = {1978}, volume = {7}, pages = {74--87} } @InProceedings{ mangasarian:condition, author = {O. L. Mangasarian}, title = {A condition number for linear inequalities and linear programs}, booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 1981}, year = {1981}, editor = {G. Bamberg and O. Opitz}, publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, address = {Konigstein}, pages = {3--15} } @Article{ mangasarian:convergence, author = {O. L. Mangasarian}, title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the Symmetric Monotone Linear Complementarity Problem}, journal = {SIAM Journal on Optimization}, volume = {1}, pages = {114--122}, year = {1991} } @Article{ mangasarian:equivalence, author = {O. L. Mangasarian}, title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, journal = {SIAM Journal on Applied Mathematics}, year = {1976}, volume = {31}, pages = {89--92} } @Article{ mangasarian:error, author = {O. L. Mangasarian}, title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, journal = {ORSA Journal on Computing}, volume = {15}, pages = {187--192}, year = {1994} } @Article{ mangasarian:error*1, author = {O. L. Mangasarian}, title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, journal = {Mathematical Programming}, year = {1990}, volume = {48}, pages = {437--445} } @Article{ mangasarian:generalized, author = {O. L. Mangasarian}, title = {Generalized Linear Complementarity Problems as Linear Programs}, journal = {Methods of Operations Research}, year = {1979}, editor = {W. Oettli and F. Steffens}, volume = {31}, pages = {393--402} } @InCollection{ mangasarian:generalized*1, author = {O. L. Mangasarian}, title = {Generalized Support Vector Machines}, year = {2000}, pages = {135-146}, booktitle = {Advances in Large Margin Classifiers}, editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, publisher = {MIT Press}, address = {Cambridge, MA} } @Article{ mangasarian:global, author = {O. L. Mangasarian}, title = {Global error bounds for monotone affine variational inequality problems}, journal = {Linear Algebra and Its Applications}, year = {1992}, pages = {153--164} } @InCollection{ mangasarian:least, author = {O. L. Mangasarian}, title = {Least Norm Solution of Non--Monotone Complementarity Problems}, booktitle = {Functional Analysis, Optimization and Mathematical Economics}, year = {1990}, publisher = {Oxford University Press}, address = {New York}, pages = {217--221} } @Article{ mangasarian:least-norm, author = {O. L. Mangasarian}, title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization Problem}, journal = {Journal of Mathematical Analysis and Applications}, year = {1983}, volume = {92}, pages = {240--251} } @Article{ mangasarian:linear, author = {O. L. Mangasarian}, title = {Linear Complementarity Problems Solvable by a Single Linear Program}, journal = {Mathematical Programming}, year = {1976}, volume = {10}, pages = {263--270} } @Article{ mangasarian:linear*1, author = {O. L. Mangasarian}, title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, journal = {Operations Research}, year = {1965}, volume = {13}, pages = {444--452} } @Article{ mangasarian:locally, author = {O. L. Mangasarian}, title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear Complementarity Problems}, journal = {Mathematical Programming}, year = {1980}, volume = {19}, pages = {200--212} } @InCollection{ mangasarian:machine, author = {O. L. Mangasarian}, title = {Machine Learning via Polyhedral Concave Minimization}, editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, pages = {175-188}, year = {1996}, address = {Heidelberg}, publisher = {Physica-Verlag A Springer-Verlag Company} } @Article{ mangasarian:mathematical, author = {O. L. Mangasarian}, title = {Mathematical Programming in Neural Networks}, journal = {ORSA Journal on Computing}, volume = {5}, pages = {349--360}, year = {1993} } @InProceedings{ mangasarian:mathematical*1, author = {O. L. Mangasarian}, title = {Mathematical Programming in Machine Learning}, booktitle = {Nonlinear Optimization and Applications}, editor = {G. Di Pillo and F. Giannessi}, publisher = {Plenum Publishing}, address = {New York}, pages = {283--295}, year = {1996} } @Article{ mangasarian:mathematical*2, author = {O. L. Mangasarian}, title = {Mathematical Programming in Data Mining}, journal = {Data Mining and Knowledge Discovery}, volume = {1}, year = {1997}, pages = {183-201} } @Article{ mangasarian:multi-surface, author = {O. L. Mangasarian}, title = {Multi-surface Method of Pattern Separation}, journal = {IEEE Transactions on Information Theory}, year = {1968}, volume = {IT-14}, pages = {801--807} } @Book{ mangasarian:nonlinear, author = {O. L. Mangasarian}, title = {Nonlinear Programming}, year = {1969}, publisher = {McGraw--Hill}, address = {New York}, note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} } @Article{ mangasarian:normal, author = {O. L. Mangasarian}, title = {Normal Solutions of Linear Programs}, journal = {Mathematical Programming Study}, year = {1984}, volume = {22}, pages = {206--216} } @Article{ mangasarian:optimal, author = {O. L. Mangasarian}, title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of Linear Programs}, journal = {Journal of Optimization Theory and Applications}, year = {1981}, volume = {35}, pages = {123--128} } @Article{ mangasarian:parallel, author = {O. L. Mangasarian}, title = {Parallel Gradient Distribution in Unconstrained Optimization}, journal = {SIAM Journal on Control and Optimization}, volume = {33}, pages = {1916--1925}, year = {1995} } @TechReport{ mangasarian:regularized, author = {O. L. Mangasarian}, title = {Regularized Linear Programs with Equilibrium Constraints}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1997}, address = {Madison, Wisconsin}, type = {Mathematical Programming Technical Report}, number = {97--13}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} } @Article{ mangasarian:simple, author = {O. L. Mangasarian}, title = {A Simple Characterization of Solution Sets of Convex Programs}, journal = {Operations Research Letters}, year = {1988}, volume = {7}, pages = {21--26} } @Article{ mangasarian:solution, author = {O. L. Mangasarian}, title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, journal = {Journal of Optimization Theory and Applications}, year = {1977}, month = aug, volume = {22}, pages = {465--485} } @Article{ mangasarian:stable, author = {O. L. Mangasarian}, title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, journal = {Linear Algebra and Its Applications}, year = {1981}, volume = {41}, pages = {209--223} } @Article{ mangasarian:sufficiency, author = {O. L. Mangasarian}, title = {Sufficiency of Exact Penalty Minimization}, journal = {SIAM Journal on Control and Optimization}, year = {1985}, month = jan, volume = {23}, pages = {30--37} } @Article{ mangasarian:unconstrained, author = {O. L. Mangasarian}, title = {Unconstrained {L}agrangians in Nonlinear Programming}, journal = {SIAM Journal on Control and Optimization}, year = {1975}, volume = {13}, pages = {772--791} } @Book{ manne.richels:buying, author = {A. S. Manne and R. G. Richels}, title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, publisher = {MIT Press}, year = {1992}, address = {Cambridge MA} } @Article{ manne.richels:global, author = {A. S. Manne and R. G. Richels}, title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, journal = {The Energy Journal}, year = {1991}, volume = {12}, pages = {87--107} } @Article{ manne.richels:international, author = {A. S. Manne and R. G. Richels}, title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, journal = {Economic Review}, year = {1991}, volume = {81}, pages = {135--139} } @Article{ manne.rutherford:international, author = {A. S. Manne and T. F. Rutherford}, title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal General Equilibrium Model}, journal = {The Energy Journal}, year = {1993}, volume = {14}, pages = {1--20} } @InCollection{ manne:eta-macro, author = {A. S. Manne}, title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, booktitle = {Modeling Energy-Economy Interactions}, year = {1977}, editor = {C. J. Hitch}, publisher = {Resources for the Future}, address = {Washington DC} } @PhDThesis{ maratos:exact, author = {N. Maratos}, title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization Problems}, year = {1978}, school = {Imperial College, University of London} } @Article{ marcotte.dussault:note, author = {P. Marcotte and J.--P. Dussault}, title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational Inequalities}, journal = {Operations Research Letters}, year = {1987}, volume = {6}, pages = {35--42} } @Article{ marcotte.zhu:exact, author = {P. Marcotte and D. L. Zhu}, title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming Problem}, journal = {Mathematical Programming}, year = {1996}, volume = {74}, pages = {141--158} } @Article{ marcotte:algorithm, author = {P. Marcotte}, title = {A New Algorithm for Solving Variational Inequalities with Application to the Traffic Assignment Problem}, journal = {Mathematical Programming}, year = {1985}, volume = {33}, pages = {339--351} } @Article{ marcotte:application, author = {P. Marcotte}, title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network Equilibrium Problems}, journal = {Information Systems and Operational Research}, year = {1991}, volume = {29}, pages = {258--270} } @Article{ marcotte:network, author = {P. Marcotte}, title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, journal = {Mathematical Programming}, year = {1986}, volume = {34}, pages = {142--162} } @Article{ markusen.rutherford.ea:el, author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, journal = {Cuadernos Economicos de Ice}, year = {1995}, volume = {59}, pages = {57--68} } @Article{ markusen.rutherford.ea:trade, author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, title = {Trade liberalization in a multinational-dominated industry}, journal = {Journal of International Economics}, year = {1995}, volume = {38}, pages = {95--118} } @Article{ markusen.rutherford:discrete, author = {J. R. Markusen and T. F. Rutherford}, title = {Discrete plant-location decisions in an applied general equilibrium model of trade liberalization}, journal = {Weltwirtshchaftliches Archiv}, year = {1994} } @Article{ markusen.wigle:nash, author = {J. Markusen and R. Wigle}, title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of Country Size, Scale Economies and Capital Mobility}, journal = {Journal of Political Mobility}, year = {1989}, volume = {97}, pages = {368--386} } @Article{ marquardt:algorithm, author = {D. W. Marquardt}, title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, journal = {SIAM Journal on Applied Mathematics}, year = {1963}, volume = {11}, pages = {431--441} } @Article{ martello.toth:algorithm, author = {S. Martello and P. Toth}, title = {A New Algorithm for the 0--1 Knapsack Problem}, journal = {Management Science}, year = {1988}, volume = {34}, pages = {633--644} } @InCollection{ martello.toth:algorithms, author = {S. Martello and P. Toth}, title = {Algorithms for Knapsack Problems}, booktitle = {Surveys in Combinatorial Optimization}, year = {1987}, editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, publisher = {Annals of Discrete Mathematics 31, North--Holland}, address = {Amsterdam} } @Article{ martello.toth:mixture, author = {S. Martello and P. Toth}, title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum Problem}, journal = {Management Science}, year = {1984}, volume = {30}, pages = {765--771} } @Article{ martello.toth:worst-case, author = {S. Martello and P. Toth}, title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, journal = {Mathematical Programming}, year = {1984}, volume = {28}, pages = {198--205} } @Article{ martinet:regularisation, author = {Bernard Martinet}, title = {Regularisation d'Inequations Variationelles par Approximations Successives}, journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, year = {1970}, volume = {4}, pages = {154--159} } @Article{ maskin.tirole:theory, author = {E. Maskin and J. Tirole}, title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large fixed costs}, journal = {Econometrica}, volume = {56}, year = {1988}, pages = {549--569} } @Article{ maskin.tirole:theory*1, author = {E. Maskin and J. Tirole}, title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and Edgeworth cycles}, journal = {Econometrica}, volume = {56}, year = {1988}, pages = {571--579} } @Article{ maskus.rutherford.ea:economic, author = {K. Maskus and T. F. Rutherford and S. Selby}, title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for {M}exico}, journal = {North American Journal of Economics and Finance}, year = {1996} } @Article{ mastor:experimental, author = {A. A. Mastor}, title = {An Experimental Investigation and Comparative Evaluation of Production Line Balancing Techniques}, journal = {Management Science}, year = {1970}, volume = {16}, pages = {728--746} } @Article{ mathias.pang:error, author = {R. Mathias and J. S. Pang}, title = {Error bounds for the linear complementarity problem with a {P}-matrix}, journal = {Linear Algebra and Its Applications}, year = {1990}, volume = {132}, pages = {123--136} } @Article{ mathiesen:algorithm, author = {L. Mathiesen}, title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a {W}alrasian Equilibrium Model: An Example}, journal = {Mathematical Programming}, year = {1987}, volume = {37}, pages = {1--18} } @Article{ mathiesen:computation, author = {L. Mathiesen}, title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity Problems}, journal = {Mathematical Programming Study}, year = {1985}, volume = {23}, pages = {144--162} } @Article{ mathiesen:computational, author = {L. Mathiesen}, title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear Complementarity Problems}, journal = {Operations Research}, year = {1985}, volume = {33}, pages = {1225--1250} } @Book{ matlab:users, author = {{MATLAB}}, title = {User's Guide}, year = {1992}, publisher = {The MathWorks, Inc.} } @Book{ mcclelland.rummelhart:explorations, author = {J. L. McClelland and D. E. Rummelhart}, title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, Programs, and Exercises}, year = {1987}, publisher = {MIT Press}, address = {Cambridge, Massachusetts} } @Article{ mccormick:modification, author = {G. P. McCormick}, title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, journal = {Mathematical Programming}, year = {1977}, volume = {13}, pages = {111--115} } @Book{ mccormick:nonlinear, author = {G. P. McCormick}, title = {Nonlinear Programming: Theory, Algorithms and Applications}, year = {1983}, publisher = {John Wiley \& Sons}, address = {New York} } @Article{ mcculloch.pitts:logical, author = {W. McCulloch and W. Pitts}, title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, journal = {Bulletin of Mathematical Biophysics}, year = {1943}, volume = {7}, pages = {115--133} } @TechReport{ mckenna.zenios:optimal, author = {M. McKenna and S. A. Zenios}, title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, institution = {Thinking Machines Corporation}, year = {1990}, type = {Working Paper}, address = {Cambridge, MA} } @Article{ mckinnon:convergence, author = {K. I. M. McKinnon}, title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, journal = {SIAM Journal on Optimization}, year = {1998}, volume = {9}, pages = {148--158} } @Article{ mcshane.monma.ea:implementation, author = {K. A. McShane and C. L. Monma and D. F. Shanno}, title = {An implementation of a primal-dual interior point method for linear programming}, journal = {ORSA Journal of Computing}, year = {1989}, volume = {1}, pages = {70--83} } @PhDThesis{ medhi:decomposition, author = {D. Medhi}, title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel Optimization}, school = {Computer Sciences Department, University of Wisconsin}, year = {1987}, address = {Madison, Wisconsin}, note = {Technical Report 718} } @Article{ medhi:parallel, author = {D. Medhi}, title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical Programming Problems}, journal = {Annals of Operations Research}, year = {1990}, volume = {22}, pages = {101--127} } @Article{ megiddo:complexity, author = {N. Megiddo}, title = {On the complexity of polyhedral separability}, journal = {Discrete and Computational Geometry}, year = {1988}, volume = {3}, pages = {325--337} } @Article{ megiddo:finding, author = {N. Megiddo}, title = {On Finding Primal-- and Dual--Optimal Bases}, journal = {ORSA Journal on Computing}, year = {1991}, volume = {3}, pages = {63--65} } @Article{ mehrotra:implementation, author = {S. Mehrotra}, title = {On the implementation of a primal-dual interior point method}, journal = {SIAM Journal on Optimization}, year = {1992}, volume = {2}, pages = {575--601} } @PhDThesis{ merrill:applications, author = {O. H. Merrill}, title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper Semicontinuous Point to Set Mappings}, year = {1972}, school = {University of Michigan} } @Article{ merten.muller:variance, author = {A. G. Merten and M. E. Muller}, title = {Variance Minimization in Single Machine Sequencing Problems}, journal = {Management Science}, year = {1972}, volume = {18}, pages = {518--528} } @TechReport{ meyer:continuity, author = {R. R. Meyer}, title = {Continuity Properties of Linear Programs}, institution = {Computer Sciences Department, University of Wisconsin}, year = {1979}, address = {Madison, Wisconsin}, number = {373} } @Article{ miersemann.mittelmann:continuation, author = {E. Miersemann and H. D. Mittelmann}, title = {Continuation for Parametrized Nonlinear Variational Inequalities}, journal = {Journal of Computational and Applied Mathematics}, year = {1989}, volume = {26}, pages = {23--34} } @Article{ mifflin:semismooth, author = {R. Mifflin}, title = {Semismooth and semiconvex functions in constrained optimization}, journal = {SIAM Journal on Control and Optimization}, year = {1977}, volume = {15}, pages = {957--972} } @Article{ mifflin:stable, author = {R. Mifflin}, title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, journal = {Mathematical Programming}, vol = {16}, pages = {141--158}, year = {1979} } @Book{ miller:survival, author = {Jr. R. G. Miller}, title = {Survival Analysis}, year = {1981}, publisher = {John Wiley \& Sons}, address = {New York} } @Book{ minsky.papert:perceptrons, author = {M. Minsky and S. Papert}, title = {Perceptrons: An Introduction to Computational Geometry}, year = {1969}, publisher = {MIT Press}, address = {Cambridge, Massachusetts} } @Article{ minty:monotone, author = {G. J. Minty}, title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, journal = {Duke Mathematics Journal}, year = {1962}, volume = {29}, pages = {341--346} } @Article{ minty:monotonicity, author = {G. J. Minty}, title = {On the Monotonicity of the Gradient of a Convex Function}, journal = {Pacific Journal of Mathematics}, year = {1964}, volume = {14}, pages = {243--247} } @TechReport{ mizuno.jarre.ea:unified, author = {S. Mizuno and F. Jarre and J. Stoer}, title = {A Unified approach to infeasible--interior--point algorithms via geometrical linear complementarity problems}, institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, address = {W{\"{u}}rzburg, Germany}, year = {1994}, number = {Nr. 213}, type = {Preprint} } @TechReport{ mizuno:polynomiality, author = {S. Mizuno}, title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm for linear programming}, institution = {School of Operations Research and Industrial Engineering, Cornell University}, year = {1993}, number = {1006}, address = {Ithaca, New York}, month = jan } @Article{ mohan.mageras.ea:clinically, author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, journal = {Medical Physics}, year = {1992}, volume = {19}, number = {4}, pages = {933--944} } @Article{ mohan:field, author = {R. Mohan}, title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf Collimation}, journal = {Seminars in Radiation Oncology}, year = {1995}, volume = {5}, number = {2}, pages = {86--99} } @Article{ monteiro.pang.ea:positive, author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, journal = {SIAM Journal on Optimization}, year = {1995}, volume = {5}, pages = {129--148} } @Article{ monteiro.tsuchiya:limiting, author = {R. D. C. Monteiro and T. Tsuchiya}, title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a Monotone Horizontal Linear Complementarity Problem}, year = {1996}, journal = {Mathematics of Operations Research}, pages = {793--814}, volume = {21} } @Article{ monteiro.wright:local, author = {R. D. C. Monteiro and S. J. Wright}, title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, journal = {Computational Optimization and Applications}, year = {1994}, volume = {3}, pages = {131--155} } @Article{ monteiro.wright:superlinear, author = {R. D. C. Monteiro and S. J. Wright}, title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, year = {1996}, journal = {SIAM Journal on Optimization}, volume = {6}, pages = {1--18} } @Article{ monteiro.wright:superlinear*1, author = {R. D. C. Monteiro and S. J. Wright}, title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, journal = {Mathematical Programming}, year = {1995}, volume = {69}, pages = {311--333} } @Article{ more.garbow.ea:testing, author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, title = {Testing Unconstrained Optimization Software}, journal = {ACM Transactions on Mathematical Software}, year = {1981}, volume = {7}, pages = {17--41} } @Article{ more.rheinboldt:p, author = {J. J. Mor\'{e} and W. C. Rheinboldt}, title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear Mappings}, journal = {Linear Algebra and Its Applications}, year = {1973}, volume = {6}, pages = {45--68} } @Article{ more.sorensen:use, author = {J. J. Mor\'{e} and D. C. Sorensen}, title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, journal = {Mathematical Programming}, year = {1979}, volume = {16}, pages = {1--20} } @Article{ more.sorensen:computing, author = {J. J. Mor\'{e} and D. C. Sorensen}, title = {Computing a Trust Region Step}, journal = {SIAM Journal on Scientific and Statistical Computing}, year = {1983}, volume = {4}, pages = {553--572} } @Article{ more.toraldo:solution, author = {J. J. Mor\'e and G. Toraldo}, title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {93--113} } @TechReport{ more.vavasis:solution, author = {J. J. Mor\'{e} and S. A. Vavasis}, title = {On the Solution of Concave Knapsack Problems}, institution = {Argonne National Laboratory}, year = {1988}, address = {Argonne, Illinois}, number = {ANL/MCS--P40--1288}, type = {Mathematics and Computer Science Division Report} } @Book{ more.wright:optimization, author = {J. J. Mor\'{e} and S. J. Wright}, title = {Optimization Software Guide}, publisher = {SIAM}, address = {Philadelphia, Pennsylvania}, series = {Frontiers in Applied Mathematics}, number = {14}, year = {1993} } @TechReport{ more.wu:global, author = {J. J. Mor\'{e} and Z. Wu}, title = {Global Continuation for Distance Geometry Problems}, institution = {Argonne National Laboratory}, year = {1995}, type = {Preprint}, number = {MCS-P505-0395}, address = {Argonne, Illinois} } @TechReport{ more.wu:issues, author = {J. J. Mor\'{e} and Z. Wu}, title = {Issues in Large-Scale Global Molecular Optimization}, institution = {Argonne National Laboratory}, year = {1995}, type = {Preprint}, number = {MCS-P539-1095}, address = {Argonne, Illinois} } @TechReport{ more:collection, author = {J. J. Mor\'e}, title = {A Collection of Nonlinear Model Problems}, institution = {Argonne National Laboratory}, year = {1989}, type = {Preprint}, address = {Argonne, Illinois}, number = {MCS-P60-0289} } @Article{ more:global, author = {J. J. Mor\'e}, title = {Global Methods for Nonlinear Complementarity Problems}, year = {1996}, journal = {Mathematics of Operations Research}, pages = {589--614}, volume = {21} } @Article{ moreau:proximite, author = {J.--J. Moreau}, title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, year = {1965}, volume = {93}, pages = {273--299} } @Article{ morrill.lane.ea:dose-volume, author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, title = {Dose-volume considerations with linear programming}, journal = {Medical Physics}, year = {1991}, volume = {18}, number = {6}, pages = {1201--1210} } @Article{ morrill:very, author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1995}, volume = {31}, pages = {179--188} } @TechReport{ morshedi.tapia:karmarkar, author = {A. M. Morshedi and R. A. Tapia}, title = {Karmarkar as a Classical Method}, institution = {Department of Mathematical Sciences, Rice University}, year = {1987}, number = {87--7}, type = {Technical Report} } @Article{ mosco:dual, author = {U. Mosco}, title = {Dual Variational Inequalities}, journal = {Journal of Mathematical Analysis and its Applications}, year = {1972}, volume = {40}, pages = {202--206} } @Article{ motzkin.schoenberg:relaxation, author = {T. S. Motzkin and I. J. Schoenberg}, title = {The relaxation method for linear inequalities}, journal = {Canadian Journal of Mathematics}, year = {1954}, volume = {6}, pages = {393--404} } @InProceedings{ muhlenbein:parallel, crossref = {schaeffer:third}, author = {H. M{\"{}u}hlenbein}, title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, pages = {416--421} } @Article{ mukhopadhyay.roy.ea:polynomial, author = {S. Mukhopadhyay and A. Roy and S. Govil}, title = {A polynomial time algorithm for generating neural networks for pattern classification: Its stability properties and some test results}, journal = {Neural Computation}, year = {1993}, volume = {5}, pages = {317--330} } @Article{ mulvey.ruszczynski:diagonal, author = {J. M. Mulvey and A. Ruszczynski}, title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, journal = {Operations Research Letters}, year = {1992}, volume = {12}, pages = {205--215} } @TechReport{ mulvey.ruszczynski:scenario, author = {J. M. Mulvey and A. Ruszczynski}, title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, institution = {Department of Civil Engineering and Operations Research, Princeton University}, year = {1991}, address = {Princeton, New Jersey}, number = {SOR 91-19}, type = {Technical Report} } @PhDThesis{ munson:algorithms, author = {T. S. Munson}, title = {Algorithms and Environments for Complementarity}, school = {University of Wisconsin--Madison}, year = {2000}, address = {Madison, Wisconsin}, month = aug, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} } @Article{ munson.facchinei.ea:semismooth, author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, journal = {INFORMS Journal on Computing}, year = {2001}, volume = {forthcoming} } @Article{ murchland:braess, author = {J. D. Murchland}, title = {Braess' Paradox of Traffic Flow}, journal = {Transportation Research}, year = {1970}, volume = {4}, pages = {391--394} } @Unpublished{ murphy.aha:uci, author = {P. M. Murphy and D. W. Aha}, title = {{UCI} Repository of Machine Learning Databases}, year = {1992}, note = {Department of Information and Computer Science, University of California, Irvine, California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} } @Book{ murphy.lawrence.ea:american, editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, title = {American Cancer Society Textbook of Clinical Oncology}, publisher = {The American Cancer Society, Inc.}, address = {Atlanta, Georgia}, year = {1995} } @Article{ murphy.sherali.ea:mathematical, author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, title = {A Mathematical Programming Approach for Determining Oligopolistic Market Equilibrium}, journal = {Mathematical Programming}, year = {1982}, volume = {24}, pages = {92--106} } @TechReport{ murtagh.saunders:minos, author = {B. A. Murtagh and M. A. Saunders}, title = {{MINOS} 5.0 User's Guide}, institution = {Stanford University}, address = {Stanford, California}, year = {1983}, number = {{SOL} 83.20}, type = {Technical Report} } @InProceedings{ murthy.kasif.ea:oc1, author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, title = {{OC1}: Randomized Induction of Oblique Decision Trees}, booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, year = {1993}, publisher = {The AAAI Press/The MIT Press}, address = {Cambridge, MA 02142}, pages = {322--327} } @Book{ murty:linear, author = {K. G. Murty}, title = {Linear Complementarity, Linear and Nonlinear Programming}, year = {1988}, publisher = {Helderman-Verlag}, address = {Berlin} } @Book{ murty:linear*1, author = {K. G. Murty}, title = {Linear Programming}, year = {1983}, publisher = {John Wiley \& Sons}, address = {New York} } @Article{ murty:number, author = {K. G. Murty}, title = {On the number of solutions of the complementarity problem and spanning properties of cones}, journal = {Linear Algebra and Its Applications}, year = {1972}, volume = {5}, pages = {65--108} } @Book{ murty:linear*2, author = {K. G. Murty}, title = {Linear and Combinatorial Programming}, year = {1976}, publisher = {John Wiley \& Sons}, address = {New York} } @Book{ nagurney:network, author = {A. Nagurney}, title = {Network Economics -- {A} Variational Inequality Approach}, publisher = {Kluwer Academic Publishers}, year = {1993}, address = {Dordrecht, The Netherlands} } @Article{ nash.nocedal:numerical, author = {S. G. Nash and J. Nocedal}, title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton Method for Large Scale Optimization}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {3}, pages = {358--372} } @Article{ nash:equilibrium, author = {J. F. Nash}, title = {Equilibrium Points in {N}--Person Games}, journal = {Proceedings of the National Academy of Sciences}, year = {1950}, volume = {36}, pages = {48--49} } @Article{ nash:non-cooperative, author = {J. F. Nash}, title = {Non-cooperative games}, journal = {Annals of Mathematics}, year = {1951}, volume = {54}, pages = {286--295} } @Article{ nash:newton-type, author = {S. G. Nash}, title = {{N}ewton--Type Minimization via {L}anczos Method}, journal = {SIAM Journal on Numerical Analysis}, year = {1984}, volume = {21}, pages = {770--788} } @Article{ nauss:efficient, author = {R. M. Nauss}, title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, journal = {Management Science}, year = {1976}, volume = {23}, pages = {27--31} } @Book{ nazareth:computer, author = {J. L. Nazareth}, title = {Computer Solution of Linear Programs}, year = {1987}, publisher = {Oxford University Press}, address = {Oxford} } @Article{ nelder.mead:simplex, title = {A Simplex Method for Function Minimization}, author = {J. A. Nelder and R. Mead}, journal = {Computer Journal}, volume = {7}, pages = {308--313}, year = {1965} } @Article{ nemhauser.savelsbergh.ea:minto, author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, title = {{MINTO}, {A} Mixed Integer Optimizer}, journal = {Operations Research Letters}, year = {1994}, optkey = {}, optvolume = {15}, optnumber = {}, optpages = {47--58}, optmonth = {}, optnote = {}, optannote = {} } @Book{ nemhauser.wolsey:integer, author = {G. L. Nemhauser and L. A. Wolsey}, title = {Integer and Combinatorial Optimization}, publisher = {John Wiley \& Sons}, year = {1988}, address = {New York, NY} } @Article{ nestor.pasurka:alternative, author = {D. Vaughn Nestor and C. Pasurka}, title = {Alternative Specifications for Environmental Control Costs in a General Equilibrium Framework}, journal = {Economics Letters}, year = {1995}, volume = {48}, pages = {273--280} } @Article{ nestor.pasurka:cge, author = {D. Vaughn Nestor and C. Pasurka}, title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects of Environmental Policy}, journal = {Economic Modelling}, year = {1995}, volume = {12}, pages = {53--59} } @Article{ newman.shapiro:theorems, author = {D. J. Newman and H. S. Shapiro}, title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, journal = {Duke Mathematical Journal}, year = {1963}, volume = {30}, pages = {673--682} } @Article{ ng.peyton:block, author = {E. Ng and B. Peyton}, title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, journal = {SIAM Journal on Scientific and Statistical Computing}, year = {1993}, volume = {14}, pages = {1034--1056} } @TechReport{ nielsen.zenios:solving, author = {S. S. Nielsen and S. A. Zenios}, title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal Algorithms}, institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, year = {1992}, address = {Philadelphia}, number = {92-01-05} } @Article{ niemierko:optimization, author = {A. Niemierko}, title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End Points and Constraints}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1992}, volume = {23}, pages = {99--108} } @InCollection{ niemierko:treatment, author = {A. Niemierko}, title = {Treatment Plan Optimization}, booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, editor = {J. A. Purdy and B. Emami}, publisher = {Medical Physics Publishing}, year = {1993}, pages = {49--55}, address = {St. Louis, Missouri} } @Article{ niemireko:optimization, author = {A. Niemierko}, title = {Optimization of intensity modulated beams: Local or global optimum?}, journal = {Medical Physics}, year = {1996}, optvolume = {23}, optpages = {1072} } @Manual{ nih:radiation, title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, author = {N. C. I. National Institutes of Health}, organization = {NIH Publication}, address = {Bethesda, Maryland}, edition = {97-2227}, year = {1997} } @Book{ nilsson:learning, author = {N. J. Nilsson}, title = {Learning Machines}, year = {1966}, publisher = {MIT Press}, address = {Cambridge, Massachusetts} } @Article{ nocedal:theory, author = {J. Nocedal}, title = {Theory of Algorithms for Unconstrained Optimization}, journal = {Acta Numerica}, year = {1992}, pages = {199--242} } @InProceedings{ noyes:neural, author = {J. L. Noyes}, title = {Neural Network Optimization Methods}, booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed Processing}, year = {1991}, publisher = {Indiana-Purdue University}, address = {Fort Wayne, Indiana}, pages = {1--12} } @Article{ nygard.juell.ea:neural, author = {K. E. Nygard and P. Juell and N. Kadaba}, title = {Neural Networks for Selecting Vehicle Routing Heuristics}, journal = {ORSA Journal on Computing}, year = {1990}, volume = {4}, pages = {353--364} } @Article{ oh.goenka:elastohydrodynamic, author = {K. P. Oh and P. K. Goenka}, title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, journal = {Transactions of the {ASME}, Journal of Tribology}, volume = {107}, year = {1985}, pages = {389--395} } @Article{ oh.li.ea:elastohydrodynamic, author = {K. P. Oh and C. H. Li and P. K. Goenka}, title = {Elastohydrodynamic Lubrication of Piston Skirts}, journal = {Transactions of the {ASME}, Journal of Tribology}, volume = {109}, pages = {356--362}, year = {1987} } @Article{ oh:analysis, author = {K. P. Oh}, title = {Analysis of a Needle Bearing}, journal = {Transactions of the {ASME}, Journal of Tribology}, volume = {106}, pages = {78--87}, year = {1984} } @Article{ oh:formulation, author = {K. P. Oh}, title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear Complementarity Problem}, journal = {Transactions of the {ASME}, Journal of Tribology}, volume = {108}, year = {1986}, pages = {598--604} } @Article{ oh:numerical, author = {K. P. Oh}, title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a Nonlinear Complementarity Problem}, journal = {Transactions of the {ASME}, Journal of Tribology}, volume = {106}, year = {1984}, pages = {88--95} } @Article{ olivera.shepard.ea:maximum, author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman and E. E. Fitchard and T. R. Mackie}, title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, journal = {Physics in Medicine and Biology}, year = {1998}, pages = {3277--3294} } @Article{ opial:weak, author = {Z. Opial}, title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive Mappings}, journal = {Bulletin of the American Mathematical Society}, year = {1967}, volume = {73}, pages = {591--597} } @Book{ orchard-hays:advanced, author = {W. Orchard--Hays}, title = {Advanced Linear Programming Computing Techniques}, year = {1968}, publisher = {McGraw--Hill}, address = {New York} } @Article{ orourke.taylor.ea:factor, author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, title = {Factor price convergence in the late nineteenth century}, journal = {International Economic Review}, year = {1996} } @Article{ orourke.williamson:open, author = {K. O'Rourke and J. G. Williamson}, title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative accounting}, journal = {Scandinavian Economic and Social History}, year = {1995}, volume = {XLIII}, pages = {171--203} } @Article{ orourke:costs, author = {K. O'Rourke}, title = {The costs of international economic disintegration: {I}reland in the 1930's}, journal = {Research in Economic History}, year = {1995}, volume = {15}, pages = {215--259} } @Article{ orourke:industrial, author = {K. O'Rourke}, title = {Industrial policy, employment policy and the non-traded sector}, journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, year = {1996} } @Article{ orourke:measuring, author = {K. O'Rourke}, title = {Measuring protection: a cautionary tale}, journal = {Journal of Development Economics}, year = {1996} } @Book{ ortega.rheinboldt:iterative, author = {J. M. Ortega and W. C. Rheinboldt}, title = {Iterative Solution of Nonlinear Equations in Several Variables}, year = {1970}, publisher = {Academic Press}, address = {San Diego, California} } @Book{ ortega:introduction, author = {J. M. Ortega}, title = {Introduction to Parallel and Vector Solution of Linear Systems}, year = {1988}, publisher = {Plenum Press}, address = {New York} } @Book{ ortega:numerical, author = {J. M. Ortega}, title = {Numerical Analysis, {A} Second Course}, year = {1972}, publisher = {Academic Press} } @Article{ osborne.womersley:strong, author = {M. R. Osborne and R. S. Womersley}, title = {Strong uniqueness in sequential linear programming}, journal = {Journal of the Australian Mathematical Society, Series B}, year = {1990}, volume = {31}, pages = {379--384} } @InCollection{ osborne:strong, author = {M. R. Osborne}, title = {Strong uniqueness in nonlinear approximation}, booktitle = {The numerical solution of nonlinear problems}, year = {1981}, editor = {C. T. H. Baker and C. Phillips}, publisher = {Clarendon Press}, address = {Oxford} } @Book{ outrata.kocvara.ea:nonsmooth, author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, publisher = {Kluwer Academic Publishers}, year = {1998}, address = {Dordrecht, The Netherlands} } @Article{ outrata.zowe:numerical, author = {J. V. Outrata and J. Zowe}, title = {A Numerical Approach to Optimization Problems with Variational Inequality Constraints}, journal = {Mathematical Programming}, year = {1995}, volume = {68}, pages = {105--130} } @Article{ outrata:necessary, author = {J. V. Outrata}, title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, journal = {Journal of Optimization Theory and Applications}, volume = {76}, year = {1993}, pages = {305--320} } @Article{ outrata:numerical, author = {J. V. Outrata}, title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, journal = {Zeitschrift f{\"{u}}r Operations Research}, volume = {4}, year = {1990}, pages = {255--278} } @Article{ outrata:optimization, author = {J. V. Outrata}, title = {On Optimization Problems with Variational Inequality Constraints}, journal = {SIAM Journal on Optimization}, volume = {4}, year = {1994}, pages = {340--357} } @Article{ paige.saunders:lsqr, author = {C. C. Paige and M. A. Saunders}, title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, journal = {{ACM} Transactions on Mathematical Software}, year = {1982}, volume = {8}, pages = {43--71} } @Article{ paige.saunders:solution, author = {C. C. Paige and M. A. Saunders}, title = {Solution of Sparse Indefinite Systems of Linear Equations}, journal = {SIAM Journal on Numerical Analysis}, year = {1975}, volume = {12}, pages = {617--629} } @Article{ palacios-gomez.lasdon.ea:nonlinear, author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, title = {Nonlinear Optimization by Successive Linear Programming}, journal = {Management Science}, year = {1982}, volume = {28}, pages = {1106--1120} } @Article{ palomares.mangasarian:superlinearly, author = {U. M. Garcia Palomares and O. L. Mangasarian}, title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained Optimization Problems}, journal = {Mathematical Programming}, year = {1976}, volume = {11}, pages = {1--13} } @Article{ panagiotopoulos.al-fahed:robot, author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, journal = {The International Journal of Robotics Research}, year = {1994}, volume = {13}, pages = {127--136} } @Book{ panagiotopoulos:hemivariational, author = {P. D. Panagiotopoulos}, title = {Hemivariational Inequalities}, publisher = {Springer-Verlag}, address = {Berlin}, year = {1993} } @Book{ panagiotopoulos:inequality, author = {P. D. Panagiotopoulos}, title = {Inequality Problems in Mechanics and Applications}, publisher = {Birkh{\"{a}}user}, address = {Boston}, year = {1985} } @Article{ pang.chan:iterative, author = {J. S. Pang and D. Chan}, title = {Iterative Methods for Variational and Complementarity Problems}, journal = {Mathematical Programming}, year = {1982}, volume = {24}, pages = {284--313} } @Article{ pang.gabriel:nesqp, author = {J. S. Pang and S. A. Gabriel}, title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, journal = {Mathematical Programming}, year = {1993}, volume = {60}, pages = {295--338} } @Article{ pang.han.ea:minimization, author = {J. S. Pang and S.--P. Han and N. Rangaraj}, title = {Minimization of Locally {L}ipschitzian Functions}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {57--82} } @Article{ pang.qi:nonsmooth, author = {J. S. Pang and L. Qi}, title = {Nonsmooth Equations: Motivation and Algorithms}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, pages = {443--465} } @Article{ pang.trinkle.ea:complementarity, author = {J. S. Pang and J. C. Trinkle and G. Lo}, title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, journal = {Computational Optimization and Applications}, volume = {5}, pages = {97--138}, year = {1996} } @Article{ pang.trinkle:complementarity, author = {J. S. Pang and J. C. Trinkle}, title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body Contact Problems with {C}oulomb Friction}, year = {1996}, journal = {Mathematical Programming}, volume = {73}, pages = {199--226} } @TechReport{ pang.wang:embedding, author = {J. S. Pang and Z. P. Wang}, title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity Problems}, institution = {Department of Mathematical Sciences, The Johns Hopkins University}, year = {1990}, address = {Baltimore, Maryland} } @TechReport{ pang.yang:parallel, author = {J. S. Pang and J. M. Yang}, title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, institution = {Department of Mathematical Sciences, The Johns Hopkins University}, year = {1987}, address = {Baltimore, Maryland}, type = {Manuscript} } @Article{ pang.yu:linearized, author = {J. S. Pang and C. S. Yu}, title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on Networks}, journal = {Networks}, volume = {14}, pages = {427--438}, year = {1984} } @Article{ pang:b-differentiable, author = {J. S. Pang}, title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically Convergent Algorithm for Nonlinear Programs, Complementarity and Variational Inequality Problems}, journal = {Mathematical Programming}, year = {1991}, volume = {51}, pages = {101--132} } @InCollection{ pang:complementarity, author = {J. S. Pang}, title = {Complementarity Problems}, booktitle = {Handbook in Global Optimization}, publisher = {Kluwer Academic Publishers}, year = {1994}, editor = {R. Horst and P. Pardalos}, address = {Boston} } @Article{ pang:convergence, author = {J. S. Pang}, title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, year = {1982}, volume = {37}, pages = {149--162} } @Article{ pang:convergence*1, author = {J. S. Pang}, title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An Application of some Sensitivity Results}, journal = {Mathematical Programming}, year = {1993}, volume = {58}, pages = {149--160} } @Article{ pang:inexact, author = {J. S. Pang}, title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {54--71} } @Article{ pang:more, author = {J. S. Pang}, title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, year = {1986}, volume = {49}, pages = {107--134} } @Article{ pang:more*1, author = {J. S. Pang}, title = {More Results on the Convergence of Iterative Methods for Symmetric Linear Complementarity Problems}, journal = {Journal of Optimization Theory and Applications}, year = {1986}, volume = {49}, pages = {107--134} } @Article{ pang:necessary, author = {J. S. Pang}, title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for the Linear Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, year = {1984}, volume = {42}, pages = {1--17} } @Article{ pang:newtons, author = {J. S. Pang}, title = {{N}ewton's Method for {B}--Differentiable Equations}, journal = {Mathematics of Operations Research}, year = {1990}, volume = {15}, pages = {311--341} } @Article{ pang:posteriori, author = {J. S. Pang}, title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality Problem}, journal = {Mathematics of Operations Research}, year = {1987}, volume = {12}, pages = {474--484} } @Article{ pantoja.mayne:sequential, author = {J. F. A. D. Pantoja and D. Q. Mayne}, title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems with Control Inequality Constraints}, journal = {International Journal on Control}, year = {1991}, volume = {53}, pages = {823--836} } @Book{ papadimitriou.steiglitz:combinatorial, author = {C. H. Papadimitriou and K. Steiglitz}, title = {Combinatorial Optimization: Algorithms and Complexity}, year = {1982}, publisher = {Prentice-Hall, Inc}, address = {Englewood Cliffs, New Jersey} } @Article{ papanikolau.mackie.ea:investigation, author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. Reckwerdt}, title = {Investigation of the convolution method for polyenergetic spectra}, journal = {Medical Physics}, year = {1993}, volume = {20}, number = {5}, pages = {1327--1336} } @Article{ parisot:resolution, author = {G. R. Parisot}, title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation Lin\'{e}aire par Application de la Programmation Logarithmique}, journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, year = {1961}, volume = {20}, pages = {227--259} } @Article{ parker.cave.ea:comparison, author = {L. R. Parker and M. R. Cave and R. M. Barnes}, title = {Comparison of Simplex Algorithms}, journal = {Analytica Chimica Acta}, year = {1985}, volume = {175}, pages = {231--237} } @InProceedings{ parker:optimal, author = {D. Parker}, title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and Second Order Hebbian Learning}, booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume II}, year = {1987}, address = {San Diego:IEEE}, pages = {593--600} } @Book{ pascali.sburlan:nonlinear, author = {D. Pascali and S. Sburlan}, title = {Nonlinear Mappings of Monotone Type}, publisher = {Editura Academeie}, year = {1978} } @Article{ passty:ergodic, author = {G. B. Passty}, title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert space}, journal = {Journal of Mathematical Analysis and Applications}, year = {1979}, volume = {72}, pages = {383--390} } @Article{ peaceman.rachford:numerical, author = {D. W. Peaceman and H. H. Rachford}, title = {The numerical solution of parabolic and elliptic differential equations}, journal = {SIAM Journal}, year = {1955}, volume = {3}, pages = {28--41} } @Book{ peck.tiesberg:global, author = {S. Peck and T. Tiesberg}, title = {Global Warming Uncertainties and the Value of Information: An Analysis Using {CETA}}, publisher = {The Electric Power Institute}, year = {1992}, address = {Paolo Alto CA} } @TechReport{ peng:convexity, author = {J. -M. Peng}, title = {The Convexity of the Implicit {L}agrangian}, institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, year = {1995}, type = {Technical Report}, address = {Beijing} } @Article{ peng:equivalence, author = {J. -M. Peng}, title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, journal = {Mathematical Programming}, year = {1997}, volume = {78}, pages = {347--356} } @Article{ pennisi:taking, author = {E. Pennisi}, title = {Taking a structured approach to understanding proteins}, journal = {Science}, year = {1998}, volume = {279}, pages = {978--979} } @Article{ penot:regularity, author = {J. P. Penot}, title = {On regularity conditions in mathematical programming}, journal = {Mathematical Programming Study}, year = {1982}, volume = {17}, pages = {28--66} } @Book{ perez:principles, author = {C. A. Perez and L. W. Brady}, title = {Principles and practice of radiotherapy}, publisher = {Lippincott-Raven}, year = {1998}, address = {Philadelphia}, edition = {3rd} } @Article{ perroni.rutherford:international, author = {C. Perroni and T. Rutherford}, title = {International Trade in Carbon Emission Rights and Basic Materials: General Equilibrium Calculations for 2020}, journal = {Scandinavian Journal of Economics}, year = {1993} } @Article{ perroni.rutherford:regular, author = {C. Perroni and T. Rutherford}, title = {Regular Flexibility of Nested {CES} Functions}, journal = {European Economic Review}, year = {1995}, volume = {39}, pages = {335--343} } @InCollection{ perroni.wigle:environmental, author = {C. Perroni and R. M. Wigle}, title = {Environmental Policy Modeling}, booktitle = {Global Trade Analysis: Modeling and Applications}, publisher = {Cambridge University Press}, year = {1996}, editor = {T. Hertel} } @Article{ peterson:review, author = {D. W. Peterson}, title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, journal = {SIAM Review}, year = {1973}, volume = {15}, pages = {639--654} } @PhDThesis{ petersson:optimization, author = {J. Petersson}, title = {Optimization of Structures in Unilateral Contact}, type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, number = {397}, school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping University}, address = {Link{\"o}ping, Sweden}, year = {1995} } @Book{ petri:modelling, author = {P. Petri}, title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, publisher = {Harvard University Press}, year = {1984} } @InProceedings{ petrzykowski:application, author = {T. Petrzykowski}, title = {Application of the Steepest Ascent Method to Concave Programming}, booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, year = {1962}, publisher = {North--Holland}, address = {Amsterdam}, pages = {185--189} } @InProceedings{ pettey.leuze.ea:parallel, crossref = {grefenstette:genetic}, author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, title = {A Parallel Genetic Algorithm}, pages = {155--161} } @InProceedings{ pettey.leuze:theoretical, crossref = {schaeffer:third}, author = {C. C. Pettey and M. R. Leuze}, title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, pages = {398--405} } @Book{ pfeiffer.glocker:multibody, author = {F. Pfeiffer and C. Glocker}, title = {Multibody Dynamics with Unilateral Contact}, year = {1996}, publisher = {John Wiley \& Sons} } @TechReport{ pierro.iusem:convergence, author = {A. R. de Pierro and A. N. Iusem}, title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite Linear Complementarity Problems}, institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, year = {1990}, address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} } @InCollection{ pillo.grippo.ea:class, author = {G. Di Pillo and L. Grippo and F. Lampariello}, title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, booktitle = {System Modelling and Optimization}, year = {1981}, editor = {R. F. Drenick and F. Kozin}, publisher = {Springer-Verlag}, address = {Berlin} } @Article{ pillo.grippo:augmented, author = {G. Di Pillo and L. Grippo}, title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming Problems}, journal = {Journal of Optimization Theory and Applications}, year = {1982}, volume = {36}, pages = {495--519} } @Article{ pillo.grippo:class, author = {G. Di Pillo and L. Grippo}, title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, journal = {SIAM Journal on Control and Optimization}, year = {1979}, volume = {17}, pages = {618--628} } @Article{ pillo.grippo:continuously, author = {G. Di Pillo and L. Grippo}, title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming Problems with Inequality Constraints}, journal = {SIAM Journal on Control and Optimization}, year = {1985}, volume = {23}, pages = {72--84} } @Article{ pillo.grippo:exact, author = {G. Di Pillo and L. Grippo}, title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear Programming Problems}, journal = {Mathematical Programming}, year = {1986}, volume = {36}, pages = {1--18} } @InProceedings{ plambeck.fu.ea:throughput, author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, editor = {J. Schoen}, year = {1993}, publisher = {Society for Computer Simulation}, address = {San Diego, CA}, pages = {70--75} } @Article{ plambeck.fu.ea:sample-path, author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, journal = {Mathematical Programming}, year = {1996}, volume = {75}, pages = {137--176} } @InProceedings{ platt:sequential, author = {J. Platt}, title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector Machines}, editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, publisher = {MIT Press}, pages = {185-208}, year = {1999} } @Book{ poincare:sur, author = {H. Poincar\'{e}}, title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, year = {1881}, publisher = {Oeuvres I}, address = {Gauthier--Villars, Paris} } @Article{ polak.ribiere:note, author = {E. Polak and G. Ribi\`{e}re}, title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, year = {1969}, volume = {16-R1}, pages = {35--43} } @Book{ polak:computational, author = {E. Polak}, title = {Computational Methods in Optimization; {A} Unified Approach}, year = {1971}, publisher = {Academic Press}, address = {New York} } @Article{ polak:global, author = {E. Polak}, title = {On the Global Stabilization of Locally Convergent Algorithms}, journal = {Automatica}, year = {1976}, volume = {12}, pages = {337--349} } @Article{ polyak.tretiyakov:concerning, author = {B. T. Polyak and N. V. Tretiyakov}, title = {Concerning an Iterative Method for Linear Programming and its Economic Interpretation}, journal = {Economics and Mathematical Methods}, year = {1972}, volume = {8}, pages = {740--751}, note = {(Russian)} } @Article{ polyak.tretiyakov:method, author = {B. T. Polyak and N. V. Tretiyakov}, title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, year = {1973}, volume = {13}, pages = {42--58} } @Article{ polyak:conjugate, author = {B. T. Polyak}, title = {The conjugate gradient method in extremal problems}, journal = {USSR Computational Mathematics and Mathematical Physics}, year = {1969}, volume = {9}, pages = {94--112}, note = {Translated from Russian} } @Book{ polyak:introduction, author = {B. T. Polyak}, title = {Introduction to Optimization}, year = {1987}, publisher = {Optimization Software, Inc.}, address = {Publications Division, New York} } @Unpublished{ polyak:methods, author = {R. A. Polyak}, title = {On the Methods of Centers}, year = {1988}, note = {Unpublished manuscript} } @Unpublished{ polyak:sharp, author = {B. T. Polyak}, title = {Sharp Minima}, year = {1979}, note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their Applications, {IIASA}, Laxenburg, Austria} } @InProceedings{ polyak:smooth, author = {R. A. Polyak}, title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium Problems with Constraints}, booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical Programming}, year = {1982}, address = {Bonn} } @Article{ polychronopoulos.tsitsiklis:analysis, author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, title = {Stochastic Shortest Path Problems with Recourse}, journal = {Networks}, year = {1996}, volume = {27}, pages = {133--143} } @TechReport{ potra.bonnans:infeasible, author = {F. A. Potra and J. F. Bonnans}, title = {Infeasible path following algorithms for linear complementarity problems}, institution = {INRIA}, year = {1994}, month = dec, number = {RR--2445}, type = {Research Report} } @Article{ potra.sheng:large-step, author = {F. A. Potra and R. Sheng}, title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, year = {1997}, journal = {SIAM Journal on Optimization}, volume = {7}, pages = {318--335} } @Article{ potra:infeasible, author = {F. A. Potra}, title = {An infeasible interior-point predictor-corrector algorithm for linear programming}, journal = {SIAM Journal on Optimization}, year = {1996}, volume = {6}, pages = {19--32} } @TechReport{ potra:onl, author = {F. A. Potra}, title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic convergence.}, institution = {Department of Mathematics, The University of Iowa}, address = {Iowa City, Iowa}, year = {1994}, number = {50}, type = {Reports on Computational Mathematics} } @TechReport{ potra:predictor-corrector, author = {F. A. Potra}, title = {On a predictor-corrector method for solving linear programs from infeasible starting points}, institution = {Department of Mathematics, University of Iowa}, address = {Iowa City, Iowa}, year = {1992}, number = {34}, type = {Reports on Computational Mathematics} } @TechReport{ potra:quadratically, author = {F. A. Potra}, title = {A quadratically convergent infeasible interior-point algorithm for linear programming}, institution = {Department of Mathematics, University of Iowa}, year = {1992}, number = {28}, address = {Iowa City, Iowa}, month = jul } @InCollection{ powell:convergence, author = {M. J. D. Powell}, title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained Optimization Calculations}, crossref = {mangasarian.meyer.ea:nonlinear*3}, pages = {27--63} } @InProceedings{ powell:direct, author = {M. J. D. Powell}, title = {A Direct Search Optimization Method that Models the Objective and Constraint Functions by Linear Interpolation}, booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, volume = {275}, year = {1994}, publisher = {Kluwer Academic Publishers}, pages = {51--67}, address = {Dordrecht, The Netherlands} } @Article{ powell:efficient, author = {M. J. D. Powell}, title = {An Efficient Method for Finding the Minimum of a Function of Several Variables without Calculating Derivatives}, journal = {Computer Journal}, year = {1964}, volume = {17}, pages = {155--162} } @InCollection{ powell:general, author = {M. J. D. Powell}, title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, booktitle = {Approximation Theory IV}, year = {1983}, editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, publisher = {Academic Press}, address = {New York}, pages = {187--218} } @InCollection{ powell:hybrid, author = {M. J. D. Powell}, title = {A hybrid method for nonlinear equations}, booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, publisher = {Gordon and Breach}, year = {1970}, editor = {P. Rabinowitz} } @TechReport{ powell:karmarkars, author = {M. J. D. Powell}, title = {{K}armarkar's algorithm: a view from nonlinear programming}, institution = {Department of Applied Mathematics and Theoretical Physics, University of Cambridge}, year = {1989}, month = nov, address = {Cambridge, CB3 9EW, England} } @InCollection{ powell:method, author = {M. J. D. Powell}, title = {A Method for Nonlinear Constraints in Minimization Problems}, booktitle = {Optimization}, year = {1969}, editor = {R. Fletcher}, publisher = {Academic Press}, address = {London}, pages = {283--298} } @Book{ prekopa:stochastic, author = {A. Pr{\'{e}}kopa}, title = {Stochastic Programming}, publisher = {Kluwer Academic Publishers}, year = {1995}, address = {Dordrecht, The Netherlands} } @Book{ press.flannery.ea:numerical, author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. Vetterling}, title = {Numerical Recipes : the Art of Scientific Computing}, publisher = {Cambridge University Press}, year = {1988} } @Article{ pruyne.livny:interfacing, author = {J. Pruyne and M. Livny}, title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, journal = {Journal on Future Generations of Computer Systems}, volume = {12}, year = {1996}, pages = {67--85} } @InCollection{ pruyne.livny:parallel, author = {J. Pruyne and M. Livny}, title = {Parallel Processing on Dynamic Resources using {CARMI}}, booktitle = {Job Scheduling Strategies for Parallel Processing}, publisher = {Springer-Verlag}, year = {1995}, editor = {D. G. Feitelson and L. Rudolph}, volume = {949}, series = {Lecture Notes in Computer Science} } @PhDThesis{ pruyne:resource, author = {J. C. Pruyne}, title = {Resource Management Services for Parallel Applications}, school = {University of Wisconsin--Madison}, year = {1996}, address = {Madison, Wisconsin} } @Book{ pshenichny.danilin:numerical, author = {B. N. Pshenichny and Yu. M. Danilin}, title = {Numerical Methods in Extremal Problems}, year = {1978}, publisher = {MIR Publishers}, address = {Moscow} } @TechReport{ qi.chen:globally, author = {L. Qi and X. Chen}, title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, institution = {School of Mathematics, University of New South Wales}, year = {1993}, annote = {revised}, address = {Sydney} } @Article{ qi.jiang:semismooth, author = {L. Qi and H. Jiang}, title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, journal = {Mathematics of Operations Research}, volume = {22}, pages = {301--325}, year = {1997} } @TechReport{ qi.peng:unconstrained, author = {H. -D. Qi and J. -M. Peng}, title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity Problems}, institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, year = {1996}, type = {Technical Report}, address = {Beijing} } @InCollection{ qi.sun:survey, author = {L. Qi and D. Sun}, title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, year = {1999}, editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, booktitle = {Progress in Optimization}, pages = {121--146}, series = {Applied Optimization}, volume = {30}, publisher = {Kluwer Academic Publishers}, address = {Dordrecht} } @Article{ qi.sun:nonsmooth, author = {L. Qi and J. Sun}, title = {A Nonsmooth Version of {N}ewton's Method}, journal = {Mathematical Programming}, year = {1993}, volume = {58}, pages = {353--368} } @Article{ qi:convergence, author = {L. Qi}, title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, journal = {Mathematics of Operations Research}, year = {1993}, volume = {18}, pages = {227--244} } @TechReport{ qi:regular, author = {L. Qi}, title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically convergent generalized {N}ewton methods for complementarity and variational inequality problems}, institution = {School of Mathematics, University of New South Wales}, year = {1997}, type = {Applied Mathematics Report}, number = {AMR 97/14}, address = {Sydney, Australia} } @Article{ radner:competitive, author = {R. Radner}, title = {Competitive Equilibrium under Uncertainty}, journal = {Econometrica}, year = {1968}, volume = {36}, pages = {31--58} } @Article{ radstrom:embedding, author = {H. R{\aa}dstr{\"{o}}m}, title = {An embedding theorem for spaces of convex sets}, journal = {Proc. Amer. Math. Soc.}, year = {1952}, volume = {3}, pages = {165--169} } @Article{ raghavachari:connections, author = {M. Raghavachari}, title = {On Connections between Zero--One Integer Programming and Concave Programming Under Linear Constraints}, journal = {Operations Research}, year = {1969}, volume = {17}, pages = {680--684} } @Article{ rajan.burridge.ea:dynamics, author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, title = {Dynamics of a rigid body in frictional contact with rigid walls}, journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, month = mar, year = {1987}, pages = {671--677} } @Article{ ralph:branching, author = {D. Ralph}, title = {On Branching Numbers of Normal Manifolds}, journal = {Nonlinear Analysis, Theory, Methods and Applications}, volume = {22}, pages = {1041--1050}, year = {1994} } @Article{ ralph:global, author = {D. Ralph}, title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the Path Search}, journal = {Mathematics of Operations Research}, year = {1994}, volume = {19}, pages = {352--389} } @InProceedings{ ralph:piecewise, author = {D. Ralph}, title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs with Linear Complementarity Constraints}, booktitle = {Proceedings of the Seventh Conference on Computational Techniques and Applications (CTAC95)}, year = {1996} } @PhDThesis{ raman:integration, author = {R. Raman}, title = {Integration of logic and heuristic knowledge in discrete optimization techniques for process systems.}, address = {Pittsburgh, Pennsylvania}, year = {1993}, school = {Department of Chemical Engineering, Carnegie Mellon University} } @PhDThesis{ rangaraj:nonsmooth, author = {Narayan Rangaraj}, title = {Nonsmooth Optimization: Algorithms and Applications}, year = {1990}, address = {Baltimore, MD}, school = {Department of Mathematical Sciences, The Johns Hopkins University} } @InProceedings{ reckwerdt.mackie.ea:three-dimensional, author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, booktitle = {Proceedings of the XII International Conference on the Use of Computers in Radiation Therapy, Salt Lake City}, year = {1997}, editor = {D. D. Leavitt and G. Starkshall}, publisher = {Medical Physics Publishing}, address = {St. Louis, Missouri}, pages = {420--422} } @Article{ reid:sparsity-exploiting, author = {J. K. Reid}, title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear Programming Bases}, journal = {Mathematical Programming}, year = {1982}, volume = {24}, pages = {55--69} } @Book{ reingold.nievergelt.ea:combinatorial, author = {E. Reingold and J. Nievergelt and N. Deo}, title = {Combinatorial Algorithms: Theory and Practice}, publisher = {Prentice-Hall, Inc}, address = {Englewood Cliffs, New Jersey} } @PhDThesis{ reinoza:degree, author = {J. A. Reinoza}, title = {A Degree for Generalized Equations}, year = {1979}, address = {Madison, Wisconsin}, school = {University of Wisconsin} } @Article{ reinoza:solving, author = {A. Reinoza}, title = {Solving Generalized Equations via Homotopies}, journal = {Mathematical Programming}, year = {1985}, volume = {31}, pages = {307--320} } @PhDThesis{ ren:computable, author = {J. Ren}, title = {Computable Error Bounds in Mathematical Programming}, school = {Computer Sciences Department, University of Wisconsin}, year = {1993}, address = {Madison, Wisconsin}, note = {Technical Report 1173} } @Article{ renegar:polynomial-time, author = {J. Renegar}, title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear Programming}, journal = {Mathematical Programming}, year = {1988}, volume = {40}, pages = {59--94} } @Article{ robbins.monro:stochastic, author = {H. Robbins and S. Monro}, title = {A Stochastic Approximation Method}, journal = {Annals of Mathematical Statistics}, year = {1951}, volume = {22}, pages = {400--407} } @Article{ robinson:analysis, author = {S. M. Robinson}, title = {Analysis of Sample-Path Optimization}, journal = {Mathematics of Operations Research}, year = {1996}, volume = {21}, pages = {513--528} } @InCollection{ robinson:bundle-based, author = {S. M. Robinson}, title = {Bundle-Based Decomposition: Conditions for Convergence}, booktitle = {Analyse Non Lin\'{e}aire}, year = {1989}, editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, publisher = {Gauthier-Villaars}, address = {Paris}, pages = {435--447} } @InCollection{ robinson:bundle-based*1, author = {S. M. Robinson}, title = {Bundle-Based Decomposition: Description and Preliminary Results}, booktitle = {System Modeling and Optimization}, year = {1986}, editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, publisher = {Springer-Verlag}, address = {Berlin}, pages = {751--756}, volume = {84}, series = {Lecture Notes in Control and Information Sciences} } @Article{ robinson:continuity, author = {S. M. Robinson}, title = {Some Continuity Properties of Polyhedral Multifunctions}, journal = {Mathematical Programming Study}, year = {1981}, volume = {14}, pages = {206--214} } @Article{ robinson:extension, author = {S. M. Robinson}, title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, journal = {Numerische Mathematik}, year = {1972}, volume = {19}, pages = {341--347} } @InCollection{ robinson:generalized, crossref = {bachem.grotschel.ea:mathematical}, author = {S. M. Robinson}, title = {Generalized Equations}, pages = {346--367} } @Article{ robinson:generalized*1, author = {S. M. Robinson}, title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, journal = {Mathematical Programming Study}, year = {1979}, volume = {10}, pages = {128--141} } @InCollection{ robinson:homeomorphism, author = {S. M. Robinson}, title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, booktitle = {Optimization and Nonlinear Analysis}, year = {1992}, editor = {A. Ioffe and M. Marcus and S. Reich}, publisher = {Longman}, address = {Harlow, Essex, England}, pages = {240--248}, series = {Pitman Research Notes in Mathematics Series No. 244} } @Article{ robinson:implicit-function, author = {S. M. Robinson}, title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, journal = {Mathematics of Operations Research}, year = {1991}, volume = {16}, pages = {292--309} } @Article{ robinson:local*1, author = {S. M. Robinson}, title = {Local Epi--Continuity and Local Optimization}, journal = {Mathematical Programming}, year = {1987}, volume = {37}, pages = {208--222} } @Article{ robinson:local*2, author = {S. M. Robinson}, title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: Nondegeneracy}, journal = {Mathematical Programming Study}, year = {1984}, volume = {22}, pages = {217--230} } @Article{ robinson:local*3, author = {S. M. Robinson}, title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: Stability and Sensitivity}, journal = {Mathematical Programming Study}, year = {1987}, volume = {30}, pages = {45--66} } @Article{ robinson:mathematical, author = {S. M. Robinson}, title = {Mathematical Foundations of Nonsmooth Embedding Methods}, journal = {Mathematical Programming}, year = {1990}, volume = {48}, pages = {221--229} } @Article{ robinson:newtons, author = {S. M. Robinson}, title = {{N}ewton's Method for a Class of Nonsmooth Functions}, journal = {Set Valued Analysis}, year = {1994}, volume = {2}, pages = {291--305} } @Article{ robinson:nonsingularity, author = {S. M. Robinson}, title = {Nonsingularity and Symmetry for Linear Normal Maps}, journal = {Mathematical Programming}, year = {1993}, volume = {62}, pages = {415--425} } @InCollection{ robinson:nonsmooth, author = {S. M. Robinson}, title = {Nonsmooth Continuation for Generalized Equations}, year = {1997}, pages = {282--291}, editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, booktitle = {Recent Advances in Optimization}, series = {Lecture Notes in Economics and Mathematical Systems}, volume = {452}, publisher = {Springer-Verlag}, address = {Heidelberg} } @Article{ robinson:normal, author = {S. M. Robinson}, title = {Normal Maps Induced by Linear Transformations}, journal = {Mathematics of Operations Research}, year = {1992}, volume = {17}, pages = {691--714} } @Article{ robinson:normed, author = {S. M. Robinson}, title = {Normed Convex Processes}, journal = {Transactions of the American Mathematical Society}, year = {1972}, volume = {174}, pages = {127--140} } @Article{ robinson:reduction, author = {S. M. Robinson}, title = {A reduction method for variational inequalities}, journal = {Mathematical Programming}, year = {1998}, volume = {80}, pages = {161--169} } @Article{ robinson:regularity, author = {S. M. Robinson}, title = {Regularity and stability for convex multivalued functions}, journal = {Mathematics of Operations Research}, year = {1976}, volume = {1}, pages = {130--143} } @Unpublished{ robinson:shadow, author = {S. M. Robinson}, title = {Shadow {JUNK} for biblio file}, year = {1800} } @Article{ robinson:shadow*1, author = {S. M. Robinson}, title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, journal = {Operations Research}, year = {1993}, volume = {41}, pages = {518--535} } @Article{ robinson:shadow*2, author = {S. M. Robinson}, title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, journal = {Operations Research}, year = {1993}, volume = {41}, pages = {536--548} } @Unpublished{ robinson:stability, author = {S. M. Robinson}, title = {Stability {JUNK} for biblio file}, year = {1800} } @Article{ robinson:stability*1, author = {S. M. Robinson}, title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, journal = {SIAM Journal on Numerical Analysis}, year = {1975}, volume = {12}, pages = {754--769} } @Article{ robinson:stability*2, author = {S. M. Robinson}, title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable Nonlinear Systems}, journal = {SIAM Journal on Numerical Analysis}, year = {1976}, volume = {13}, pages = {497--513} } @Article{ robinson:strongly, author = {S. M. Robinson}, title = {Strongly Regular Generalized Equations}, journal = {Mathematics of Operations Research}, year = {1980}, volume = {5}, pages = {43--62} } @Article{ rockafellar.wets:generalized, author = {R. T. Rockafellar and R. J.--B. Wets}, title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal Control in Discrete Time}, journal = {SIAM Journal on Control and Optimization}, year = {1990}, volume = {28}, pages = {810--822} } @Article{ rockafellar.wets:lagrangian, author = {R. T. Rockafellar and R. J.--B. Wets}, title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems in Stochastic Programming}, journal = {Mathematical Programming Study}, year = {1986}, volume = {28}, pages = {63--93} } @InCollection{ rockafellar.wets:linear-quadratic, author = {R. T. Rockafellar and R. J.--B. Wets}, title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite Generation Algorithm}, booktitle = {Stochastic Optimization}, publisher = {Springer-Verlag}, year = {1987}, editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, pages = {545--560}, address = {New York, Berlin} } @Article{ rockafellar.wets:scenarios, author = {R. T. Rockafellar and R. J.--B. Wets}, title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, journal = {Mathematics of Operations Research}, year = {1991}, volume = {10}, pages = {119--147} } @InProceedings{ rockafellar:applications, author = {R. T. Rockafellar}, title = {New Applications of Duality in Convex Programming}, booktitle = {Proceedings of the Fourth Conference on Probability}, year = {1971}, address = {Brasov, Romania} } @Article{ rockafellar:augmented, author = {R. T. Rockafellar}, title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, journal = {SIAM Journal on Control and Optimization}, year = {1974}, volume = {12}, pages = {268--285} } @Article{ rockafellar:augmented*1, author = {R. T. Rockafellar}, title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in Convex Programming}, journal = {Mathematics of Operations Research}, year = {1976}, volume = {1}, pages = {97--116} } @Article{ rockafellar:characterization, author = {R. T. Rockafellar}, title = {Characterization of the subdifferentials of convex functions}, journal = {Pacific Journal of Mathematics}, year = {1966}, volume = {17}, number = {3}, pages = {497--510} } @Article{ rockafellar:computational, author = {R. T. Rockafellar}, title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic Programming}, journal = {Mathematical Programming}, year = {1990}, volume = {48}, pages = {447--474} } @Book{ rockafellar:conjugate, author = {R. T. Rockafellar}, title = {Conjugate Duality and Optimization}, year = {1974}, publisher = {SIAM}, address = {Philadelphia, Pennsylvania}, volume = {16}, series = {Conference Board of the Mathematical Sciences} } @Book{ rockafellar:convex, author = {R. T. Rockafellar}, title = {Convex Analysis}, year = {1970}, publisher = {Princeton University Press}, address = {Princeton, New Jersey} } @Article{ rockafellar:first-, author = {R. T. Rockafellar}, title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, journal = {Transactions of the American Mathematical Society}, year = {1988}, volume = {307}, pages = {75--108} } @InProceedings{ rockafellar:generalized, author = {R. T. Rockafellar}, title = {A Generalized Approach to Linear-Quadratic Programming}, booktitle = {Proceedings of the International Conference on Numerical Optimization and Applications}, year = {1986}, pages = {58--66}, note = {(Xi'an, China)} } @InProceedings{ rockafellar:generalized*1, crossref = {bachem.grotschel.ea:mathematical}, author = {R. T. Rockafellar}, title = {Generalized Subgradients in Mathematical Programming}, pages = {368--390} } @InCollection{ rockafellar:large-scale, author = {R. T. Rockafellar}, title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, chapter = {15}, year = {1991}, editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, publisher = {SIAM Publications}, pages = {247--261} } @Article{ rockafellar:linear-quadratic, author = {R. T. Rockafellar}, title = {Linear-Quadratic Programming and Optimal Control}, journal = {SIAM Journal on Control and Optimization}, year = {1987}, volume = {25}, pages = {781--814} } @Article{ rockafellar:maximality, author = {R. T. Rockafellar}, title = {On the Maximality of Sums of Nonlinear Monotone Operators}, journal = {Transactions of the American Mathematical Society}, year = {1970}, volume = {149}, pages = {75--88} } @InCollection{ rockafellar:monotone, author = {R. T. Rockafellar}, title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, crossref = {mangasarian.meyer.ea:nonlinear*3}, pages = {1--26} } @Article{ rockafellar:monotone*1, author = {R. T. Rockafellar}, title = {Monotone Operators and the Proximal Point Algorithm}, journal = {SIAM Journal on Control and Optimization}, year = {1976}, volume = {14}, pages = {877--898} } @Article{ rockafellar:multiplier, author = {R. T. Rockafellar}, title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, journal = {Journal of Optimization Theory and Applications}, year = {1973}, volume = {12}, pages = {555--562} } @Article{ rockafellar:multistage, author = {R. T. Rockafellar}, title = {Multistage Convex Programming and Discrete-Time Optimal Control}, journal = {Control and Cybernetics}, year = {1988}, volume = {17}, number = {2-3}, pages = {225--245} } @Book{ rockafellar:network, author = {R. T. Rockafellar}, title = {Network Flows and Monotropic Optimization}, publisher = {John Wiley}, year = {1984}, address = {New York} } @Article{ rodrigues:mixed, author = {H. C. Rodrigues}, title = {A mixed variational formulation for shape optimization of solids with contact conditions}, journal = {Structural Optimization}, volume = {6}, year = {1993}, pages = {19--28} } @Book{ rodrigues:obstacle, author = {J. F. Rodrigues}, title = {Obstacle Problems in Mathematical Physics}, publisher = {Elsevier Publishing Company}, address = {Amsterdam}, year = {1987} } @Book{ roos.terlaky.ea:theory, author = {C. Roos and T. Terlaky and J.--Ph. Vial}, title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, publisher = {John Wiley \& Sons}, year = {1997}, address = {Chichester} } @TechReport{ rosa:decomposition, author = {C. H. Rosa}, title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, institution = {IIASA}, year = {1996}, number = {WP-96-013}, address = {A-2361 Laxenburg, Austria} } @Article{ rosen.lane.ea:treatment, author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, title = {Treatment Plan Optimization Using Linear Programming}, journal = {Medical Physics}, year = {1990}, volume = {18}, number = {2}, pages = {141--152} } @TechReport{ rosenblatt:perceptron-a, author = {F. Rosenblatt}, title = {The perceptron--a perceiving and recognizing automaton}, institution = {Cornell Aeronautical Laboratory}, year = {1957}, month = jan, address = {Ithaca, New York}, number = {85-460-1} } @Book{ rosenblatt:principles, author = {F. Rosenblatt}, title = {Principles of Neurodynamics}, year = {1962}, publisher = {Spartan Books}, address = {New York} } @InProceedings{ rosenblatt:two, author = {F. Rosenblatt}, title = {Two theorems of statistical separability in the perceptron}, booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, year = {1959}, publisher = {{HMS} Stationery Office}, address = {London}, volume = {1} } @Article{ rosenbrock:automatic, author = {H. H. Rosenbrock}, title = {Automatic Method for Finding the Greatest or Least Value of a Function}, journal = {Computer Journal}, year = {1960}, volume = {3}, pages = {175--184} } @Article{ roy.mukhopadhyay:pattern, author = {A. Roy and S. Mukhopadhyay}, title = {Pattern Classification Using Linear Programming}, journal = {ORSA Journal on Computing}, year = {1990}, volume = {3}, pages = {66--80} } @Book{ rubinstein:monte, author = {R. Rubinstein}, title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing Networks}, publisher = {Wiley}, address = {New York, NY}, year = {1986} } @Article{ ruchala.olivera.ea:comparison, author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, journal = {Physics in Medicine and Biology, forthcoming}, year = {1999} } @Book{ rudin:principles, author = {W. Rudin}, title = {Principles of Mathematical Analysis}, year = {1976}, publisher = {McGraw--Hill}, address = {Tokyo, Japan}, edition = {Third} } @Book{ rudin:real, author = {W. Rudin}, title = {Real and Complex Analysis}, year = {1974}, publisher = {McGraw--Hill}, address = {Tokyo, Japan}, edition = {Second} } @InProceedings{ rumelhart.hinton.ea:learning, author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, title = {Learning Internal Representations by Error Propagation}, booktitle = {Parallel Distributed Processing}, year = {1986}, editor = {D. E. Rumelhart and J. L. McClelland}, publisher = {MIT Press}, address = {Cambridge, Massachusetts}, pages = {318--362} } @Book{ rumelhart.mcclelland:parallel, author = {D. E. Rumelhart and J. L. McClelland}, title = {Parallel Distributed Processing}, year = {1986}, publisher = {MIT Press}, address = {Cambridge, Massachusetts} } @InCollection{ ruszczynski:regularized, author = {A. Ruszczynski}, title = {On the Regularized Decomposition for Stochastic Programming Problems}, year = {1995}, booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, editor = {K. Marti and P. Kall}, publisher = {Springer-Verlag}, address = {Berlin}, volume = {425}, series = {Lecture Notes in Control and Information Sciences}, pages = {93--108} } @Article{ rutherford.rutstrom.ea:lacord, author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation quantitative}, journal = {Revue d' Economie du developpement}, year = {1994} } @InCollection{ rutherford.tarr:blueprints, author = {T. Rutherford and D. Tarr}, title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small Open Economy}, booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, publisher = {Cambridge University Press}, year = {1997}, editor = {R. Baldwin and J. Francois}, address = {New York} } @Article{ rutherford:applied, author = {T. F. Rutherford}, title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An Overview of the Modeling Framework and Syntax}, year = {1999}, volume = {14}, pages = {1--46}, journal = {Computational Economics} } @PhDThesis{ rutherford:applied*1, author = {T. F. Rutherford}, title = {Applied General Equilibrium Modeling}, school = {Stanford University}, year = {1987} } @Article{ rutherford:extensions, author = {T. F. Rutherford}, title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic Analysis}, journal = {Journal of Economic Dynamics and Control}, volume = {19}, pages = {1299--1324}, year = {1995} } @Misc{ rutherford:gnuplot, author = {T. F. Rutherford}, title = {A Libinclude Interface to Gnuplot from {GAMS}}, organization = {Department of Economics, University of Colorado}, address = {Boulder, Colorado}, note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} } @Unpublished{ rutherford:miles, author = {T. F. Rutherford}, title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, year = {1993}, note = {Working Paper, Department of Economics, University of Colorado, Boulder} } @TechReport{ rutherford:modeling, author = {T. F. Rutherford}, title = {A Modeling System for Applied General Equilibrium Analysis}, type = {Cowles Foundation Discussion Paper}, number = {836}, institution = {Yale University}, year = {1987} } @TechReport{ rutherford:mpsge, author = {T. F. Rutherford}, title = {{MPSGE}}, institution = {University of Western Ontario}, year = {1988}, address = {London, Ontario} } @Article{ rykov:simplex, author = {A. S. Rykov}, title = {Simplex Direct Search Algorithms}, journal = {Automation and Remote Control}, year = {1980}, volume = {41}, pages = {784--793} } @Article{ saad.schultz:gmres, author = {Y. Saad and M. Schultz}, title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric Linear Systems}, journal = {SIAM Journal on Scientific and Statistical Computing}, year = {1986}, volume = {44}, pages = {856--869} } @Book{ saad:iterative, author = {Y. Saad}, title = {Iterative Methods for Sparse Linear Systems}, year = {1996}, publisher = {PWS Publishing Company}, address = {Boston, Massachusetts} } @Article{ sahni:approximate, author = {S. Sahni}, title = {Approximate Algorithms for the 0/1 Knapsack Problem}, journal = {jacm}, year = {1975}, volume = {22}, pages = {115--124} } @InProceedings{ sauer.shepard.ea:comparison, author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, booktitle = {Proceedings of the XII International Conference on the Use of Computers in Radiation Therapy, Salt Lake City}, year = {1997}, editor = {D. D. Leavitt and G. Starkshall}, publisher = {Medical Physics Publishing}, address = {St. Louis, Missouri} } @Article{ sauer.xu:multivariate, author = {Th. Sauer and Y. Xu}, title = {On Multivariate {L}agrange Interpolation}, journal = {Mathematics of Computation}, year = {1995}, volume = {64}, pages = {1147--1170} } @Article{ savelsbergh:preprocessing, author = {M. W. P. Savelsbergh}, title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, journal = {ORSA Journal on Computing}, year = {1994}, volume = {6}, pages = {445--454} } @Article{ scarf:approximation, author = {H. E. Scarf}, title = {The Approximation of Fixed Points of a Continuous Mapping}, journal = {SIAM Journal on Applied Mathematics}, year = {1967}, volume = {15}, pages = {1328--1343} } @Book{ scarf:computation, author = {H. E. Scarf}, title = {The Computation of Economic Equilibria}, year = {1973}, publisher = {Yale University Press}, address = {New Haven, Connecticut} } @TechReport{ scheel.scholtes:mathematical, author = {H. Scheel and S. Scholtes}, title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, and Sensitivity}, institution = {Judge Institute of Management Studies, University of Cambridge}, year = {1998}, type = {Technical Report}, address = {Cambridge, England} } @Article{ schlick:modified, author = {T. Schlick}, title = {Modified {C}holesky Factorization for Sparse Preconditioners}, journal = {SIAM Journal on Scientific Computing}, year = {1993}, volume = {14}, pages = {424--445} } @Article{ schnabel.eskow:modified, author = {R. B. Schnabel and E. Eskow}, title = {A New Modified {C}holesky Factorization}, journal = {SIAM Journal on Scientific and Statistical Computing}, year = {1991}, volume = {11}, pages = {1136--1158} } @Article{ schneider.zenios:comparative, author = {M. H. Schneider and S. A. Zenios}, title = {A Comparative Study of Algorithms for Matrix Balancing}, journal = {Operations Research}, year = {1990}, volume = {38}, pages = {439--455} } @Book{ scholkopf.burges.ea:advances, editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, title = {Advances in Kernel Methods: Support Vector Machines}, publisher = {MIT Press}, address = {Cambridge, MA }, year = {1998}, isbn = {0-262-19416-3} } @Article{ scholtes.stohr:exact, author = {S. Scholtes and M. St{\"{o}}hr}, title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, journal = {SIAM Journal on Control and Optimization}, volume = {37}, pages = {617--652}, year = {1999} } @TechReport{ scholtes:introduction, author = {S. Scholtes}, title = {Introduction to piecewise differentiable equations}, institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, Universit{\"{a}}t Karlsruhe}, year = {1994}, type = {Preprint}, number = {No. 53/1994}, address = {Karlsruhe, Germany} } @Article{ schramm.zowe:version, author = {H. Schramm and J. Zowe}, title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual Idea, Convergence Analysis, Numerical Results}, journal = {SIAM Journal on Optimization}, year = {1992}, volume = {2}, pages = {121--152} } @Article{ schultz.meyer:interior, author = {G. L. Schultz and R. R. Meyer}, title = {An Interior Point Method for Block Angular Optimization}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {583--602} } @InProceedings{ sekiguchi.sato.ea:ninf, author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, title = {Ninf: Network based Information Library for Globally High Performance Computing}, booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, year = {1996}, address = {Santa Fe} } @InCollection{ sellami.robinson:homotopies, author = {H. Sellami and S. M. Robinson}, title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational Inequalities}, booktitle = {Nonlinear Optimization and Applications}, editor = {G. Di Pillo and F. Giannessi}, year = {1996}, pages = {327--343}, publisher = {Plenum Press}, address = {New York} } @Article{ sellami.robinson:implementation, author = {H. Sellami and S. M. Robinson}, title = {Implementation of a Continuation Method for Normal Maps}, journal = {Mathematical Programming}, year = {1997}, volume = {76}, pages = {563--578} } @PhDThesis{ sellami:continuation, author = {H. Sellami}, title = {A Continuation Method for Normal Maps}, school = {University of Wisconsin -- Madison}, year = {1994}, address = {Madison, Wisconsin} } @Article{ sellami:homotopy, author = {H. Sellami}, title = {A Homotopy Continuation Method for Normal Maps}, journal = {Mathematical Programming}, vol = {82}, year = {1998}, pages = {317--337} } @Book{ seuss:one, author = {{Dr.} A. Seuss}, title = {One Fish, Two Fish, Red Fish, Blue Fish}, year = {1960}, publisher = {Beginner Books}, address = {New York}, series = {Beginner Books, B13}, note = {A story--poem about the activities of such unusual animals as the Nook, Wump, Yink, Yop, Gack, and the Zeds} } @Article{ seyfferth.pfeiffer:dynamics, author = {W. Seyfferth and F. Pfeiffer}, title = {Dynamics of Assembly Processes With a Manipulator}, journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots and Systems}, year = {1992}, pages = {1303--1310} } @Article{ shanno.simantiraki:infeasible, author = {D. Shanno and E. Simantiraki}, title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, year = {1997}, journal = {SIAM Journal on Optimization}, volume = {7}, pages = {620--640} } @InProceedings{ shanno.simantiraki:interior, author = {D. Shanno and E. Simantiraki}, title = {Interior Point Methods for Linear and Nonlinear Programming}, booktitle = {State of the Art in Numerical Analysis}, year = {1997}, editor = {I. S. Duff and G. A. Watson}, publisher = {Oxford University Press}, address = {Oxford} } @Article{ shannon:introduction, author = {R. E. Shannon}, title = {Introduction to the Art and Science of simulation}, journal = {WSC98 1998 Winter simulation conference proceedings}, year = {1998}, volume = {1}, pages = {7--14} } @TechReport{ shapiro:concepts, author = {A. Shapiro}, title = {On Concepts of Directional Differentiability}, institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, year = {1988}, address = {Pretoria, South Africa}, number = {73/88(18)}, type = {Research Report} } @Book{ shavlik.editors:readings, author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, title = {Readings in Machine Learning}, year = {1990}, publisher = {Morgan Kaufman}, address = {San Mateo, California} } @Article{ shavlik.mooney.ea:symbolic, author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, journal = {Machine Learning}, year = {1991}, volume = {6}, pages = {111--143} } @Book{ sheffi:urban, author = {Y. Sheffi}, title = {Urban Transportation Networks}, publisher = {Prentice-Hall, Inc}, year = {1985}, address = {Englewood Cliffs, New Jersey} } @Article{ sheng.potra:quadratically, author = {R. Sheng and F. A. Potra}, title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with Polynomial {CO}mplexity}, journal = {SIAM Journal on Optimization}, year = {1997}, volume = {7}, pages = {304--317} } @InProceedings{ shepard.angelos.ea:simple, author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, title = {A Simple Model for Examining Radiotherapy Optimization}, booktitle = {Proceedings of the XII International Conference on the Use of Computers in Radiation Therapy, Salt Lake City}, year = {1997}, editor = {D. D. Leavitt and G. Starkshall}, publisher = {Medical Physics Publishing}, address = {St. Louis, Missouri} } @Article{ shepard.ferris.ea:inverse, author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, journal = {Medical Physics}, volume = {27}, pages = {12}, year = {2000}, key = {93} } @Article{ shepard.ferris.ea:optimizing, author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, title = {Optimizing the Delivery of Radiation to Cancer Patients}, journal = {SIAM Review}, volume = {41}, pages = {721--744}, year = {1999}, url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, key = {68}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {98-07}, type = {Mathematical Programming Technical Report} } @Article{ sherali.shetty:finitely, author = {H. D. Sherali and C. M. Shetty}, title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar Cuts and Disjunctive Face Cuts}, journal = {Mathematical Programming}, year = {1980}, volume = {19}, pages = {14--31} } @Article{ sherali.soyster.ea:stackelberg-nash-cournot, author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, journal = {Operations Research}, year = {1983}, volume = {31}, pages = {253--276} } @Article{ shi.olafsson.ea:hybrid, author = {L. Shi and S. \'{O}lafsson and Q. Chen}, title = {A New Hybrid Optimization Algorithm}, journal = {Computers and Industrial Engineering}, year = {1999}, volume = {36}, pages = {409--426} } @PhDThesis{ shiau:iterative, author = {T.--H. Shiau}, title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, school = {Computer Sciences Department, University of Wisconsin}, year = {1983}, address = {Madison, Wisconsin}, note = {Technical Report 507} } @InProceedings{ shor:generalized, crossref = {bachem.grotschel.ea:mathematical}, author = {N. Z. Shor}, title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space Dilation Operations}, pages = {501--529} } @Book{ shor:minimization, author = {N. Z. Shor}, title = {Minimization Methods for Nondifferentiable Functions}, year = {1985}, publisher = {Springer-Verlag}, address = {Berlin} } @Article{ shoven.whalley:applied, author = {J. Shoven and J. Whalley}, title = {Applied General Equilibrium Models of Taxation and International Trade: Introduction and Survey}, journal = {Journal of Economic Literature}, year = {1984}, volume = {22}, pages = {1007--1051} } @Article{ shultz.meyer:interior, author = {G. L. Shultz and R. R. Meyer}, title = {An Interior Point Method for Block Angular Optimization}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {583--602} } @Article{ shultz.schnabel.ea:family, author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, journal = {SIAM Journal on Numerical Analysis}, year = {1985}, volume = {22}, pages = {44--67} } @Article{ sibony:methodes, author = {M. Sibony}, title = {Methodes iteratives pur les equations et inequations aux derives partielles nonlineaires de type monotone}, journal = {Calcolo}, year = {1970}, volume = {7}, pages = {65--183} } @Article{ sidney:optimal, author = {J. B. Sidney}, title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, journal = {Operations Research}, year = {1977}, volume = {25}, pages = {62--69} } @Book{ siegel:corba, author = {J. Siegel}, title = {{CORBA} - Fundamentals and Programming}, publisher = {John Wiley \& Sons}, year = {1996}, address = {New York, New York} } @TechReport{ simantiraki.shanno:infeasible-interior-point, author = {E. Simantiraki and D. F. Shanno}, title = {An infeasible-interior-point algorithm for linear complementarity problems}, type = {Research Report}, number = {7-95}, institution = {Rutgers Center for Operations Research, Rutgers University}, address = {New Brunswick, New Jersey}, year = {1995} } @InProceedings{ simantiraki.shanno:infeasible-interior-point*1, author = {E. Simantiraki and D. F. Shanno}, title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity Problems}, crossref = {ferris.pang:complementarity}, pages = {386--404} } @Book{ simpson:artificial, author = {P. K. Simpson}, title = {Artificial Neural Systems}, year = {1990}, publisher = {Pergamon Press}, address = {New York} } @Article{ smeers:computable, author = {Y. Smeers}, title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity and Gas Markets}, journal = {The Energy Journal}, year = {1997}, optkey = {}, optvolume = {18}, optnumber = {}, optmonth = {}, optpages = {1--32}, optnote = {}, optannote = {} } @Article{ smith:design, author = {F. W. Smith}, title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design Procedures}, journal = {IEEE Transactions on Computers}, year = {1969}, volume = {18}, pages = {367--372} } @Article{ smith:existence, author = {M. J. Smith}, title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, journal = {Transportation Research}, year = {1979}, volume = {13B}, pages = {295--304} } @Article{ smith:existence*1, author = {M. J. Smith}, title = {The existence and calculation of traffic equilibria}, journal = {Transportation Research}, volume = {17B}, year = {1983}, pages = {291--303} } @Article{ smith:pattern, author = {F. W. Smith}, title = {Pattern Classifier Design by Linear Programming}, journal = {IEEE Transactions on Computers}, year = {1968}, volume = {C-17}, pages = {367--372} } @Article{ solodov.svaiter:projection, author = {M. V. Solodov and B. F. Svaiter}, title = {A New Projection Method for Variational Inequality Problems}, journal = {SIAM Journal on Control and Optimization}, volume = {37}, pages = {765--776}, year = {1999} } @Article{ solodov.tseng:modified, author = {M. V. Solodov and P. Tseng}, title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, year = {1996}, journal = {SIAM Journal on Control and Optimization}, pages = {1814--1830}, volume = {34} } @Article{ solodov:stationary, author = {M. V. Solodov}, title = {Stationary Points of Bound Constrained Minimization Reformulations of Complementarity Problems}, journal = {Journal of Optimization Theory and Applications, forthcoming}, year = {1997} } @Article{ spendley.hext.ea:sequential, author = {W. Spendley and G. R. Hext and F. R. Himsworth}, title = {Sequential Application of Simplex Designs in Optimization and Evolutionary Operation}, journal = {Technometrics}, year = {1962}, pages = {441--461}, volume = {4} } @Article{ spingarn:applications, author = {J. E. Spingarn}, title = {Applications of the Method of Partial Inverses to Convex Programming}, journal = {Mathematical Programming}, year = {1985}, volume = {32}, pages = {199--223} } @Book{ srinivasan.whalley:general, author = {T. Srinivasan and J. Whalley}, title = {General Equilibrium Trade Policy Modelling}, publisher = {MIT Press}, year = {1986}, address = {Boston} } @Book{ stackelberg:theory, author = {H. Van Stackelberg}, title = {The Theory of Market Economy}, publisher = {Oxford University Press}, year = {1952} } @Article{ stavroulakis.panagiotopoulos.ea:rigid, author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and Applications}, journal = {Computers \& Structures}, volume = {40}, year = {1991}, pages = {599--614} } @Article{ stavroulakis:optimal, author = {G. E. Stavroulakis}, title = {Optimal prestress of cracked unilateral structures: finite element analysis of an optimal control problem for variational inequalities}, journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, year = {1996} } @Article{ stavroulakis:optimal*1, author = {G. E. Stavroulakis}, title = {Optimal prestress of structures with frictional unilateral contact interfaces}, journal = {Archives of Applied Mechanics, forthcoming}, year = {1996} } @Book{ steenbrink:optimization, author = {P. A. Steenbrink}, title = {Optimization of Transport Networks}, publisher = {John Wiley \& Sons}, address = {London, England}, year = {1974} } @Article{ stephens:asymptotic, author = {M. A. Stephens}, title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, journal = {Annals of Statistics}, year = {1976}, volume = {4}, pages = {357--369} } @Article{ stephens:edf, author = {M. A. Stephens}, title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, journal = {Journal of the American Statistical Association}, year = {1974}, volume = {69}, pages = {730--737} } @Article{ stevens:location, author = {B. H. Stevens}, title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, journal = {Papers of the Regional Science Association}, year = {1968}, volume = {21}, pages = {19--34} } @Article{ stewart.trinkle:implicit, author = {D. E. Stewart and J. C. Trinkle}, title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic Collisions and {C}oulomb Friction}, journal = {International Journal for Numerical Methods in Engineering}, year = {1996}, volume = {39}, pages = {2673--2691} } @Book{ stoer.bulirsch:introduction, author = {J. Stoer and R. Bulirsch}, title = {Introduction to Numerical Analysis}, year = {1980}, publisher = {Springer-Verlag}, address = {New York} } @Article{ stoer:complexity, author = {J. Stoer}, title = {The complexity of an infeasible interior--point path--following method for the solution of linear programs}, journal = {Optimization Methods and Software}, year = {1994}, volume = {3}, pages = {1--12} } @Article{ stone:cross-validatory, author = {M. Stone}, title = {Cross-validatory choice and assessment of statistical predictions}, journal = {Journal of the Royal Statistical Society}, year = {1974}, volume = {36}, pages = {111--147} } @Article{ stone.smith.ea:inverse, author = {R. A. Stone and V. Smith and L. Verhey}, title = {Inverse Planning for the {G}amma {K}nife}, journal = {Medical Physics}, year = {1993}, volume = {20}, pages = {865} } @Book{ strang:linear, author = {G. Strang}, title = {Linear Algebra and its Applications}, year = {1980}, publisher = {Academic Press}, address = {New York}, edition = {Second} } @InProceedings{ street.wolberg.ea:nuclear, author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, booktitle = {Biomedical Image Processing and Biomedical Visualization}, year = {1993}, publisher = {SPIE--The International Society for Optical Engineering}, address = {San Jose, California}, pages = {861--870}, volume = {1905} } @Article{ subramanian:gauss-newton, author = {P. K. Subramanian}, title = {Gauss--{N}ewton Methods for the Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, year = {1993}, volume = {77}, pages = {467--482} } @PhDThesis{ subramanian:iterative, author = {P. K. Subramanian}, title = {Iterative Methods of Solution for Complementarity Problems}, year = {1985}, address = {Madison, Wisconsin}, school = {Computer Sciences Department, University of Wisconsin} } @TechReport{ subramanian:note, author = {P. K. Subramanian}, title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, institution = {Mathematics Research Center, University of Wisconsin--Madison}, year = {1985}, address = {Madison, Wisconsin}, number = {2844}, type = {Technical Summary Report} } @TechReport{ suh.gucht:distributed, author = {J. Y. Suh and D. Van Gucht}, title = {Distributed Genetic Algorithms}, institution = {Computer Science Department, Indiana University}, year = {1987}, address = {Bloomington}, number = {225} } @Article{ sun.natori.ea:computational, author = {S. M. Sun and M. C. Natori and K. C. Park}, title = {A Computational Procedure for Flexible Beams with Frictional Contact Constraints}, journal = {International Journal for Numerical Methods in Engineering}, volume = {36}, pages = {3781--3800}, year = {1993} } @Article{ sun.qi:ncp-functions, author = {D. Sun and L. Qi}, title = {On {NCP}-Functions}, journal = {Computational Optimization and Applications, forthcoming}, year = {1998} } @Article{ sun.womersley:unconstrained, author = {D. Sun and R. S. Womersley}, title = {A new unconstrained differentiable merit function for box constrained variational inequality problems and a damped {G}auss-{N}ewton method}, journal = {SIAM Journal on Optimization}, year = {1999}, volume = {9}, pages = {388--413} } @Article{ sun:class, author = {D. Sun}, title = {A Class of Iterative Methods for Nonlinear Projection Equations}, journal = {Journal of Optimization Theory and Applications}, year = {1996}, volume = {91}, pages = {123--140} } @PhDThesis{ sun:monotropic, author = {J. Sun}, title = {On Monotropic Piecewise Quadratic Programming}, school = {University of Washington}, year = {1986}, address = {Seattle, Washington} } @Article{ sun:thermal, author = {D. C. Sun}, title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, journal = {Journal of Applied Mechanics}, volume = {58}, pages = {141--153}, year = {1991} } @Article{ sundararaghavan.ahmed:minimizing, author = {P. S. Sundararaghavan and M. U. Ahmed}, title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine Scheduling}, journal = {Naval Research Logistics Quarterly}, year = {1984}, volume = {31}, pages = {325--333} } @TechReport{ sznajder.gowda:generalizations, author = {R. Sznajder and M. S. Gowda}, title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and horizontal {LCP}s}, institution = {Department of Mathematics, University of Maryland--Baltimore County}, year = {1992}, address = {Catonsville, Maryland}, number = {92--16}, type = {Research Report} } @Article{ sznajder.gowda:nondegeneracy, author = {R. Sznajder and M. S. Gowda}, title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, journal = {Mathematics of Operations Research}, year = {1998}, volume = {23}, pages = {221--238} } @Article{ taji.fukushima.ea:globally, author = {K. Taji and M. Fukushima and T. Ibaraki}, title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational Inequalities}, journal = {Mathematical Programming}, year = {1993}, volume = {58}, pages = {369--383} } @Article{ taji.fukushima:optimization, author = {K. Taji and M. Fukushima}, title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity Problem}, journal = {Journal of the Operations Research Society of Japan}, year = {1994}, volume = {37}, pages = {310--331} } @Article{ talbot.patterson.ea:comparative, author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, journal = {Management Science}, year = {1986}, volume = {32}, pages = {430--454} } @Article{ talman.yamamoto:simplicial, author = {A. J. J. Talman and Y. Yamamoto}, title = {A {S}implicial Algorithm for Stationary Point Problems}, journal = {Mathematics of Operations Research}, year = {1989}, volume = {14}, pages = {383--399} } @InProceedings{ tanese:distributed, crossref = {schaeffer:third}, author = {R. Tanese}, title = {Distributed Genetic Algorithms}, pages = {434--439} } @InProceedings{ tanese:parallel, crossref = {grefenstette:genetic}, author = {R. Tanese}, title = {Parallel Genetic Algorithms for a Hypercube}, pages = {177--183} } @Article{ teboulle:entropic, author = {M. Teboulle}, title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, year = {1992}, journal = {Mathematics of Operations Research}, volume = {17}, pages = {670--690} } @Article{ thuente:duality, author = {D. J. Thuente}, title = {Duality Theory for Generalized Linear Programs with Computational Methods}, journal = {Operations Research}, year = {1980}, volume = {28}, pages = {1005--1011} } @Book{ tikhonov.arsenin:solutions, author = {A. N. Tikhonov and V. Y. Arsenin}, title = {Solutions of Ill--Posed Problems}, year = {1977}, publisher = {John Wiley \& Sons}, address = {New York} } @InProceedings{ tin-loi.ferris:complementarity, author = {F. Tin-Loi and M. C. Ferris}, title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, booktitle = {Computational Mechanics for the Next Millenium}, key = {79}, pages = {1029--1036}, year = {1999}, editor = {C. M. Wang and K. H. Lee and K. K. Ang}, volume = {2}, series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational Mechanics}, url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, publisher = {Elsevier Science Ltd}, type = {Mathematical Programming Technical Report}, institution = {Computer Sciences Department, University of Wisconsin}, address = {Madison, Wisconsin}, number = {99-02} } @InProceedings{ tin-loi.ferris:holonomic, author = {F. Tin-Loi and M. C. Ferris}, title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, booktitle = {Advances in Fracture Research}, year = {1997}, editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, volume = {2}, publisher = {Pergamon Press}, pages = {2183--2190}, key = {53} } @InProceedings{ tin-loi.ferris:simple, author = {F. Tin-Loi and M. C. Ferris}, title = {A Simple Mathematical Programming Method for a Structural Identification Problem}, booktitle = {Seventh International Conference on Computing in Civil and Building Engineering (ICCCBE-VII), Seoul, Korea, 19-21 August}, editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, publisher = {Techno-Press}, address = {Korea}, year = {1997}, pages = {511--518}, key = {59} } @Article{ tin-loi.misa:large, author = {F. Tin-Loi and J. S. Misa}, title = {Large displacement elastoplastic analysis of semirigid steel frames}, journal = {International Journal for Numerical Methods in Engineering}, volume = {39}, pages = {741--762}, year = {1996} } @Article{ tin-loi.pang:elastoplastic, author = {F. Tin-Loi and J. S. Pang}, title = {Elastoplastic analysis of structures with nonlinear hardening}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {107}, year = {1993}, pages = {299--312} } @Article{ tin-loi.vimonsatit:nonlinear, author = {F. Tin-Loi and V. Vimonsatit}, title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, journal = {Engineering Structures}, volume = {18}, year = {1996}, pages = {115--124} } @Article{ tobin:uniqueness, author = {R. L. Tobin}, title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, journal = {Annals of Operations Research}, volume = {34}, year = {1992}, pages = {21--36} } @Article{ tobin:variable, author = {R. L. Tobin}, title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium Problem}, journal = {Mathematical Programming}, year = {1988}, volume = {40}, pages = {33--51} } @Article{ todd.burrell:extension, author = {M. J. Todd and B. P. Burrell}, title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual Variables}, journal = {Algorithmica}, year = {1986}, volume = {1}, pages = {409--424} } @Book{ todd:computation, author = {M. J. Todd}, title = {Computation of Fixed Points and Applications}, publisher = {Springer-Verlag}, year = {1976}, volume = {124}, series = {Lecture Notes in Economics and Mathematical Systems}, address = {Heidelberg} } @Article{ todd:note, author = {M. J. Todd}, title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of Production}, journal = {Journal of Mathematical Economics}, year = {1976}, volume = {6}, pages = {135--144} } @Article{ toint:assesment, author = {Ph. L. Toint}, title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained Optimization}, year = {1996}, journal = {SIAM Journal on Scientific Computing}, volume = {17}, pages = {725=-739} } @TechReport{ toint:assesment*1, author = {Ph. L. Toint}, title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained Optimization: The Complete Numerical Results}, institution = {Department of Mathematics, FUNDP}, year = {1994}, number = {94/15}, address = {Namur, Belgium} } @Article{ toint:global, author = {Ph. L. Toint}, title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization in a {H}ilbert Space}, journal = {IMA Journal of Numerical Analysis}, year = {1988}, volume = {8}, pages = {231--252} } @Article{ toint:non-monotone, author = {Ph. L. Toint}, title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to Convex Constraints}, year = {1997}, journal = {Mathematical Programming}, volume = {77}, pages = {69--94} } @InCollection{ toint:transportation, author = {Ph. L. Toint}, title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation Management}, publisher = {Springer-Verlag}, series = {NATO ASI Series F}, year = {1997}, editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} } @Article{ tomlin.welch:finding, author = {J. Tomlin and J. Welch}, title = {Finding Duplicate Rows in a Linear Programming Model}, journal = {Operations Research Letters}, year = {1986}, volume = {5}, number = {1}, pages = {7--11} } @Article{ torczon:convergence, author = {V. Torczon}, title = {On the Convergence of the Multidirectional Search Algorithm}, journal = {SIAM Journal on Optimization}, year = {1991}, volume = {1}, pages = {123--145} } @Article{ torczon:convergence*1, author = {V. Torczon}, title = {On the Convergence of Pattern Search Algorithms}, journal = {SIAM Journal on Optimization}, year = {1997}, volume = {7}, pages = {1--25} } @Misc{ torma.rutherford:general, author = {H. Torma and T. Rutherford}, title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, year = {1992}, howpublished = {Working Paper 15/1992}, note = {Department of Economics and Management, University of Jyvaskyla, Finland} } @Article{ trinkle.pang.ea:dynamic, author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, title = {On Dynamic Multi-Rigid-Body Contact Problems}, journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, year = {1997}, pages = {267--279}, volume = {77} } @InProceedings{ trinkle.pang:dynamic, author = {J. C. Trinkle and J. S. Pang}, title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, book = {{IEEE} International Conference on Robotics and Automation}, pages = {2276--2281}, year = {1997} } @TechReport{ tseng.bertsekas:convergence, author = {P. Tseng and D. P. Bertsekas}, title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of Technology}, year = {1990}, type = {technical report}, number = {LIDS-P-1995}, address = {Cambridge, MA} } @Article{ tseng.yamashita.ea:equivalence, author = {P. Tseng and N. Yamashita and M. Fukushima}, title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified Approach}, year = {1996}, journal = {SIAM Journal on Optimization}, volume = {6}, pages = {446--460} } @Article{ tseng:applications, author = {P. Tseng}, title = {Applications of a splitting algorithm to decomposition in convex programming and variational inequalities}, journal = {SIAM Journal on Control and Optimization}, year = {1991}, volume = {29}, pages = {119--138} } @Article{ tseng:dual, author = {P. Tseng}, title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear Constraints: a Unified Approach}, journal = {SIAM Journal on Control and Optimization}, year = {1990}, volume = {28}, pages = {214--242} } @Article{ tseng:dual*1, author = {P. Tseng}, title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} Unified Approach}, journal = {SIAM Journal on Control and Optimization}, year = {1990}, volume = {28}, pages = {214--242} } @Article{ tseng:dual*2, author = {P. Tseng}, title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, journal = {Mathematical Programming}, year = {1993}, volume = {59}, pages = {231--248} } @Article{ tseng:fortified-descent, author = {P. Tseng}, title = {Fortified-Descent Simplicial Search Method: a General Approach}, journal = {SIAM Journal on Optimization}, volume = {10}, pages = {269--288}, year = {2000} } @Article{ tseng:growth, author = {P. Tseng}, title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity Problem}, journal = {Journal of Optimization Theory and Applications}, volume = {89}, year = {1996}, pages = {17--37} } @Unpublished{ tseng:matlab, author = {P. Tseng}, title = {Matlab Implementations of Complementarity Codes}, year = {1995}, note = {Private Communication} } @Article{ ursescu:multifunctions, author = {C. Ursescu}, title = {Multifunctions with closed convex graph}, journal = {Czech. Math. J.}, year = {1975}, volume = {35}, pages = {438--441} } @TechReport{ vaidya:algorithm, author = {P. M. Vaidya}, title = {An Algorithm for Linear Programming which Requires {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, institution = {AT\&T Bell Laboratories}, year = {1987}, address = {Murray Hill, New Jersey} } @Article{ val:unloading, author = {P. Du Val}, title = {The Unloading Problem for Plane Curves}, journal = {American Journal of Mathematics}, year = {1940}, volume = {62}, pages = {307--311} } @InCollection{ valentine:problem, author = {F. A. Valentine}, title = {The Problem of {L}agrange with Differential Inequalities as Added Side Conditions}, booktitle = {Contributions to the Calculus of Variations, 1933--1937}, year = {1937}, publisher = {University of Chicago Press}, address = {Chicago}, pages = {407--448} } @Article{ valle.poch.ea:comparison, author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, title = {Comparison of the {P}owell and Simplex Methods in the Optimization of Flow-Injection Systems}, journal = {Analytica Chimica Acta}, year = {1990}, volume = {241}, pages = {31--42} } @Article{ vandenberghe.demoor.ea:generalized, author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, title = {The generalized linear complementarity problem applied to the complete analysis of resistive piecewise-linear circuits}, journal = {IEEE Transactions on Circuits and Systems}, volume = {36}, year = {1989}, pages = {1382--1391} } @Article{ vanderbei.meketon.ea:modification, author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, title = {A Modification of {K}armarkar's Algorithm}, journal = {Algorithmica}, year = {1986}, volume = {1}, pages = {395--407} } @Article{ vanderbei:affine-scaling, author = {R. J. Vanderbei}, title = {Affine--Scaling for Linear Programs with Free Variables}, journal = {Mathematical Programming}, year = {1989}, volume = {43}, pages = {31--44} } @Article{ vanroy.wolsey:solving, author = {T. J. Van~Roy and L. A. Wolsey}, title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, journal = {Operations Research}, volume = {35}, pages = {45--57}, year = {1987} } @Book{ vapnik:nature, author = {V. N. Vapnik}, title = {The Nature of Statistical Learning Theory}, publisher = {John Wiley \& Sons}, address = {New York}, year = {1996} } @Book{ varian:microeconomic, author = {Hal R. Varian}, title = {Microeconomic Analysis}, year = {1978}, publisher = {W.W. Norton \& Company}, address = {New York, New York} } @Article{ verhey:immobilizing, author = {L. J. Verhey}, title = {Immobilizing and Positioning Patients for Radiotherapy}, journal = {Seminars in Radiation Oncology}, year = {1995}, volume = {5}, number = {2}, pages = {100--113} } @Article{ vinante.pintos:differentiable, author = {C. Vinante and S. Pintos}, title = {On Differentiable Exact Penalty Functions}, journal = {Journal of Optimization Theory and Applications}, year = {1986}, volume = {50}, pages = {479--493} } @Article{ vlach:scheduling, author = {M. Vlach}, title = {On Scheduling with Earliness and Tardiness Penalties}, journal = {Methods of Operations Research}, year = {1983}, volume = {45}, pages = {367--375} } @InCollection{ wacker:summary, author = {H.--J. Wacker}, title = {A Summary of the Developments on Imbedding Methods}, booktitle = {Continuation Methods}, year = {1978}, editor = {H.--J. Wacker}, publisher = {Academic Press}, address = {New York}, pages = {1--35} } @Article{ wakefield.tin-loi:large, author = {R. R. Wakefield and F. Tin-Loi}, title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity Formulation}, journal = {Computer Methods in Applied Mechanics and Engineering}, volume = {84}, year = {1990}, pages = {229--242} } @Article{ wakefield.tin-loi:large*1, author = {R. R. Wakefield and F. Tin-Loi}, title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} Approach}, journal = {International Journal Mechanical Science}, volume = {33}, year = {1991}, pages = {379--391} } @Article{ walker:implementation, author = {H. F. Walker}, title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, journal = {SIAM Journal on Scientific Computing}, volume = {9}, year = {1988}, pages = {152--163} } @Book{ wall.schwartz:programming, author = {L. Wall and R. L. Schwartz}, title = {Programming Perl}, publisher = {O'Reilly and Associates, Inc.}, address = {Sebastopol, CA}, year = {1991} } @Book{ walras:elements, author = {L. Walras}, title = {Elements of Pure Economics}, publisher = {Allen and Unwin}, year = {1954}, address = {London} } @Article{ wang.monteiro.ea:interior, author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, title = {An Interior Point Potential Reduction Method for Constrained Equations}, journal = {Mathematical Programming}, volume = {74}, pages = {159--196}, year = {1996} } @Article{ wardi:stochastic, author = {Y. Wardi}, title = {A Stochastic Steepest-Descent Algorithm}, journal = {Journal of Optimization Theory and Applications}, year = {1988}, volume = {59}, pages = {307--323} } @Article{ wardi:stochastic*1, author = {Y. Wardi}, title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, journal = {Journal of Optimization Theory and Applications}, year = {1990}, volume = {64}, pages = {399--417} } @Article{ wardrop:theoretical, author = {J. G. Wardrop}, title = {Some Theoretical Aspects of Road Traffic Research}, journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, year = {1952}, pages = {325--378} } @Article{ warga:minimizing, author = {J. Warga}, title = {Minimizing certain convex functions}, journal = {Journal of SIAM on Applied Mathematics}, year = {1963}, volume = {11}, pages = {588--593} } @Article{ watson.billups.ea:hompack, author = {L. T. Watson and S. C. Billups and A. P. Morgan}, title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy Algorithms}, journal = {{ACM} Transactions on Mathematical Software}, year = {1987}, volume = {13}, pages = {281--310} } @Article{ watson.billups.ea:slow, author = {L. T. Watson and S. C. Billups and C. Y. Wang}, title = {Slow Viscous Flow in a Syringe}, journal = {Journal of Biomechanical Engineering}, year = {1986}, volume = {108}, pages = {317--323} } @Article{ watson:discrete, author = {G. A. Watson}, title = {Discrete $\ell_1$ approximation by rational functions}, journal = {IMA Journal of Numerical Analysis}, year = {1984}, volume = {4}, pages = {275--288} } @Article{ watson:solving, author = {L. T. Watson}, title = {Solving the nonlinear complementarity problem by a homotopy method}, journal = {SIAM Journal on Control and Optimization}, year = {1979}, volume = {17}, pages = {36--46} } @Article{ webb:optimum, author = {S. Webb}, title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient Heterogeneity}, journal = {Physics in Medicine and Biology}, year = {1994}, volume = {39}, pages = {1895--1914} } @Book{ webb:physics, author = {S. Webb}, title = {The Physics of Conformal Radiotherapy: Advances in Technology}, publisher = {Institute of Physics Publishing Ltd.}, year = {1997}, optaddress = {Philadelphia} } @InBook{ webb:theory, author = {S. Webb}, editor = {E. Sternick}, title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, publisher = {Advanced Medical Publishing}, year = {1997} } @Book{ weiss.kulikowski:computer, author = {S. M. Weiss and C. A. Kulikowski}, title = {Computer Systems that Learn}, year = {1991}, publisher = {Morgan Kaufmann Publishers, Inc}, address = {San Mateo, California} } @PhDThesis{ werbos:beyond, author = {P. J. Werbos}, title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial Sciences}, year = {1974}, school = {Harvard University} } @InCollection{ wets:convergence, author = {R. J.-B. Wets}, title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization Problems}, booktitle = {Variational Inequalites and Complementarity Problems}, year = {1980}, editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, publisher = {John Wiley \& Sons}, address = {New York}, pages = {375--403} } @InCollection{ wets:large, author = {R. J.-B. Wets}, title = {Large Scale Linear Programming Techniques in Stochastic Programming}, booktitle = {Numerical Techniques for Stochastic Optimization}, publisher = {Springer-Verlag}, year = {1988}, editor = {Yu. M. Ermoliev and R. J. -B. Wets}, address = {Berlin}, pages = {65--93} } @Article{ white:asymptotic, author = {H. White}, title = {Some asymptotic results for learning in single hidden-layer feedforward network models}, journal = {Journal of the American Stattistical Association}, year = {1989}, volume = {84}, number = {408}, pages = {1003--1013} } @Article{ white:learning, author = {H. White}, title = {Learning in artificial neural networks{:} {A} statistical perspective}, journal = {Neural Computation}, year = {1989}, volume = {1}, pages = {425--461} } @InProceedings{ whitley.starkweather.ea:scheduling, crossref = {schaeffer:third}, author = {D. Whitley and T. Starkweather and D. Fuquay}, title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination Operator}, pages = {133--140} } @Book{ williams:model, author = {H. P. Williams}, title = {Model Building in Mathematical Programming}, publisher = {John Wiley \& Sons}, year = {1990}, edition = {Third} } @Book{ wilmott.dewynne.ea:option, author = {P. Wilmott and J. Dewynne and S. Howison}, title = {Option Pricing}, publisher = {Oxford Financial Press}, year = {1993}, address = {Oxford, England} } @PhDThesis{ wilson:simplicial, author = {R. B. Wilson}, title = {A Simplicial Algorithm for Concave Programming}, year = {1963}, address = {Boston, MA}, school = {Graduate School of Business Administration, Harvard University} } @TechReport{ wolberg.bennett.ea:breast, author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of Wisconsin}, year = {1992}, address = {Madison, WI 53706}, type = {Manuscript} } @Article{ wolberg.mangasarian:multisurface, author = {W. H. Wolberg and O. L. Mangasarian}, title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast Cytology}, journal = {Proceedings of the National Academy of Sciences,U.S.A.}, year = {1990}, volume = {87}, pages = {9193--9196} } @Unpublished{ wolberg.mangasarian:wbcd, author = {W. H. Wolberg and O. L. Mangasarian}, title = {{WBCD: Wisconsin Breast Cancer Database}}, year = {1991}, note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} } @Article{ wolberg.street.ea:breast, author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, title = {Breast Cytology Diagnosis via Digital Image Analysis}, journal = {Analytical and Quantitative Cytology and Histology}, year = {1993}, volume = {15}, number = {6}, pages = {396--404} } @Unpublished{ wolberg.street.ea:wdbc, author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, year = {1995}, note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} } @Unpublished{ wolberg.street.ea:wpbc, author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, year = {1995}, note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} } @Book{ wolsey:integer, author = {L. A. Wolsey}, title = {Integer Programming}, publisher = {John Wiley \& Sons}, year = {1998}, address = {New York, NY} } @Article{ womersley:local, author = {R. S. Womersley}, title = {Local Properties of Algorithms for Minimizing Composite Functions}, journal = {Mathematical Programming}, year = {1985}, volume = {32}, pages = {69--89} } @Article{ woo.sanders.ea:peacock, author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, title = {Does the ``peacock'' have anything to do with radiotherapy?}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1994}, volume = {29}, number = {1}, pages = {213--214} } @Article{ wright.ralph:superlinear, author = {S. J. Wright and D. Ralph}, title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity Problems}, year = {1996}, journal = {Mathematics of Operations Research}, volume = {21}, pages = {815--838} } @TechReport{ wright.zhang:superquadratic, author = {S. J. Wright and Y. Zhang}, title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity problems}, institution = {Argonne National Laboratory}, year = {1994}, annote = {revised}, number = {MCS--P418--0294}, address = {Argonne, Illinois}, type = {Preprint} } @TechReport{ wright:dynfgm, author = {S. E. Wright}, title = {{DYNFGM}: Dynamic Finite Generation Method}, institution = {Department of Mathematics, University of Washington}, year = {1989}, address = {Seattle, Washington} } @Article{ wright:infeasible-interior-point, author = {S. J. Wright}, title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, journal = {Mathematical Programming}, volume = {67}, pages = {29--51}, year = {1994} } @Article{ wright:path-following, author = {S. J. Wright}, title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, journal = {Optimization Methods and Software}, year = {1993}, volume = {2}, pages = {79--106} } @TechReport{ wright:path-following*1, author = {S. J. Wright}, title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic Problems}, institution = {Argonne National Laboratory}, year = {1993}, number = {MCS--P401--1293}, address = {Argonne, Illinois} } @Book{ wright:primal-dual, author = {S. J. Wright}, title = {Primal--Dual Interior--Point Methods}, year = {1997}, publisher = {SIAM}, address = {Philadelphia, Pennsylvania} } @TechReport{ wright:reduced, author = {S. J. Wright}, title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, institution = {Argonne National Laboratory}, year = {2000}, number = {MCS--P808--0400}, address = {Argonne, Illinois} } @Article{ wright:solution, author = {S. J. Wright}, title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, journal = {Parallel Computing}, year = {1990}, volume = {16}, pages = {221--238} } @Article{ wu.bourland:morphology, author = {Q. J. Wu and J. D. Bourland}, title = {Morphology-guided radiosurgery treatment planning and optimization for multiple isocenters}, journal = {Medical Physics}, year = {1999}, volume = {26}, number = {10}, pages = {2151--2160} } @Misc{ wunderling:soplex, author = {R. Wunderling}, title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, howpublished = {http://www.zib.de/Optimization/Software/Soplex/} } @Article{ xiao.harker:nonsmooth, author = {B. Xiao and P. T. Harker}, title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, journal = {Mathematical Programming}, year = {1994}, volume = {65}, pages = {151--194} } @Article{ xiao.harker:nonsmooth*1, author = {B. Xiao and P. T. Harker}, title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical Results}, journal = {Mathematical Programming}, year = {1994}, volume = {65}, pages = {195--216} } @Article{ xiao.zhou:nonmonotone, author = {Y. Xiao and F. J. Zhou}, title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained Minimization}, journal = {Computing}, year = {1992}, volume = {48}, pages = {303--317} } @TechReport{ xiao:global, author = {B. Xiao}, title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a {B}-differentiable equation approach}, type = {{Ph.D. Thesis}}, year = {1990}, institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, address = {Philadelphia, PA} } @Article{ xu.burke:polynomial, author = {S. Xu and J. V. Burke}, title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on {C}hen-{H}arker-{K}anzow Smoothing Techniques}, year = {1999}, journal = {Mathematical Programming}, volume = {86}, pages = {91--104} } @TechReport{ xu:global, author = {S. Xu}, title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following Algorithm for Complementarity Problems with Uniform {P}-Functions}, institution = {Department of Mathematics, University of Washington}, year = {1996}, type = {Technical Report}, address = {Seattle, WA} } @Article{ yajima.konno:efficient, author = {Y. Yajima and H. Konno}, title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming Problems}, journal = {Journal of Global Optimization}, year = {1991}, volume = {1:1}, pages = {155--171} } @Article{ yamamoto:path-following, author = {Y. Yamamoto}, title = {A Path--Following Algorithm for Stationary Point Problems}, journal = {Journal of Operations Society of Japan}, year = {1987}, volume = {30}, pages = {181--198} } @Article{ yamashita.fukushima:modified, author = {N. Yamashita and M. Fukushima}, title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone Complementarity Problems}, journal = {Mathematical Programming}, year = {1997}, volume = {76}, pages = {469--492} } @Article{ yamashita.fukushima:stationary, author = {N. Yamashita and M. Fukushima}, title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity Problems}, journal = {Journal of Optimization Theory and Applications}, volume = {84}, pages = {653--663}, year = {1995} } @Article{ yamashita.taji.ea:unconstrained, author = {N. Yamashita and K. Taji and M. Fukushima}, title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, journal = {Journal of Optimization Theory and Applications}, year = {1997}, volume = {92}, pages = {439--456} } @TechReport{ yamashita:properties, author = {N. Yamashita}, title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear Complementarity Problem}, institution = {Department of Applied Mathematics and Physics, Kyoto University}, year = {1996}, type = {Technical Report}, address = {Kyoto, Japan} } @Article{ yang.mackie.ea:investigation, author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. Thomadsen}, title = {An investigation of tomotherapy beam delivery}, journal = {Medical Physics}, year = {1997}, volume = {24}, number = {3}, pages = {425--436} } @Article{ yan.shu.ea:clinical, author = {Y. Yan and H. Shu and X. Bao}, title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit Treatmen System}, journal = {International Journal of Radiation Oncology, Biology and Physics}, year = {1997}, volume = {39}, pages = {247--254} } @Article{ yau.gao:obstacle, author = {S. T. Yau and Y. Gao}, title = {Obstacle problem for von {K}arm\'an equations}, journal = {Advances in Applied Mathematics}, volume = {13}, year = {1992}, pages = {123--141} } @Article{ ye.tse:extension, author = {Y. Ye and E. Tse}, title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic Programming}, journal = {Mathematical Programming}, year = {1989}, volume = {44} } @Article{ ye:affine, author = {Y. Ye}, title = {On affine scaling algorithms for nonconvex quadratic programming}, journal = {Mathematical Programming}, year = {1992}, volume = {56}, pages = {285--300} } @PhDThesis{ ye:interior, author = {Y. Ye}, title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex Programming}, year = {1987}, address = {Stanford, California}, school = {Department of Engineering--Economic Systems, Stanford University} } @Book{ ye:interior*1, author = {Y. Ye}, title = {Interior-Point Algorithms: Theory and Analysis}, publisher = {John Wiley \& Sons}, year = {1997}, address = {New York, NY} } @Article{ yu:convergence, author = {W. --C. Yu}, title = {The Convergence Property of the Simplex Evolutionary Techniques}, journal = {Scientia Sinica, Special issue of Mathematics}, year = {1979}, volume = {1}, pages = {68--77} } @Article{ yu.schell:genetic, author = {Y. Yu and M. C. Schell}, title = {A Genetic Algorithm for the Optimization of Prostate Implants}, journal = {Medical Physics}, year = {1996}, volume = {23}, pages = {2085--2091} } @Article{ yuan:superlinear, author = {Y. Yuan}, title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth Optimization}, journal = {Mathematical Programming}, year = {1985}, volume = {31}, pages = {269--285} } @Book{ zangwill:nonlinear, author = {W. I. Zangwill}, title = {Nonlinear Programming: {A} Unified Approach}, year = {1969}, publisher = {Prentice-Hall, Inc}, address = {Englewood Cliffs, New Jersey} } @TechReport{ zangwill:nonlinear*1, author = {W. I. Zangwill}, title = {Nonlinear Programming by Sequential Unconstrained Maximization}, institution = {Center for Research in Management Science, University of California}, year = {1965}, address = {Berkeley}, number = {131}, type = {Working Paper} } @Article{ zangwill:nonlinear*2, author = {W. I. Zangwill}, title = {Nonlinear Programming via Penalty Functions}, journal = {Management Science}, year = {1967}, volume = {13}, pages = {344--358} } @TechReport{ zenios.censor:massively, author = {S. A. Zenios and Y. Censor}, title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation Problems}, institution = {decision sciences department, Wharton School, University of Pennsylvania}, year = {1990}, type = {report}, number = {89-09-10}, address = {Philadelphia, PA} } @Article{ zenios.lasken:nonlinear, author = {S. A. Zenios and R. A. Lasken}, title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, journal = {Annals of Operations Research}, year = {1988}, volume = {14}, pages = {147--163} } @Article{ zenios.mulvey:distributed, author = {S. A. Zenios and J. M. Mulvey}, title = {A Distributed Algorithm for Convex Network Optimization Problems}, journal = {Parallel Computing}, year = {1988}, volume = {6}, pages = {43--56} } @TechReport{ zenios.neilsen:massively, author = {S. A. Zenios and S. Neilsen}, title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, year = {1990}, type = {report}, number = {90-03-01}, address = {Philadelphia, PA} } @TechReport{ zenios.qi.ea:comparative, author = {S. A. Zenios and R. Qi and E. D. Chajakis}, title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for Nonlinear Network Optimization}, institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, year = {1990}, type = {report}, number = {89-10-02}, address = {Philadelphia, PA} } @Article{ zhang.kim.ea:improved, author = {J. Zhang and N.--H. Kim and L. Lasdon}, title = {An Improved Successive Linear Programming Algorithm}, year = {1985}, journal = {Management Science}, volume = {31}, pages = {1312--1331} } @Article{ zhang.tapia.ea:superlinear, author = {Y. Zhang and R. A. Tapia and F. Potra}, title = {On the Superlinear Convergence of Interior Points Algorithms for a general class of problems}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, number = {?}, pages = {413--422}, } @Article{ zhang.tapia:superlinearly, author = {Y. Zhang and R. A. Tapia}, title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for linear programming}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, pages = {118--133} } @TechReport{ zhang.zhang:superlinear, author = {Y. Zhang and D. Zhang}, title = {Superlinear convergence of infeasible interior-point methods for linear programming}, institution = {Department of Mathematics and Statistics, University of Maryland}, year = {1992}, number = {92-15}, address = {Baltimore County, Maryland} } @Article{ zhang:convergence, author = {Yin Zhang}, title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the Horizontal Linear Complementarity Problem}, journal = {SIAM Journal on Optimization}, year = {1994}, volume = {4}, pages = {208--227} } @Article{ zhang:convergence*1, author = {Y. Zhang}, title = {On the convergence of a class of infeasible interior-point methods for the horizontal linear complementarity problem}, journal = {SIAM Journal on Optimization}, year = {1994}, volume = {4}, pages = {208--227} } @Article{ zhu.rockafellar:primal-dual, author = {C. Y. Zhu and R. T. Rockafellar}, title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic Programming}, journal = {SIAM Journal on Optimization}, year = {1993}, volume = {3}, pages = {751--783} } @Article{ zhu:modified, author = {C. Y. Zhu}, title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, journal = {Computational Optimization and Applications}, year = {1992}, volume = {2}, pages = {182--205} } @Article{ zhu:primal-dual, author = {C. Y. Zhu}, title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic Programming}, journal = {SIAM Journal on Optimization}, year = {1995}, volume = {5}, pages = {114--128} } @Book{ zoutendijk:methods, author = {G. Zoutendijk}, title = {Methods of Feasible Directions}, year = {1960}, publisher = {Elsevier Publishing Company}, address = {Amsterdam} } @Article{ zowe.kurcyusz:regularity, author = {J. Zowe and S. Kurcyusz}, title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, journal = {Applied Mathematics and Optimization}, year = {1979}, volume = {5}, pages = {49--62} } @InProceedings{ zowe:nondifferentiable, author = {J. Zowe}, title = {Nondifferentiable Optimization}, booktitle = {Computational Mathematical Programming}, year = {1985}, editor = {K. Schittkowski}, publisher = {Springer-Verlag}, address = {Berlin} } @Proceedings{ bachem.grotschel.ea:mathematical, booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, title = {Mathematical Programming: The State of the Art, Bonn 1982}, year = {1983}, editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, publisher = {Springer Verlag}, address = {Berlin} } @Proceedings{ belew.booker:fourth, year = {1991}, editor = {R. K. Belew and L. B. Booker}, publisher = {Morgan Kaufmann Publishers, Inc}, address = {San Mateo, California}, booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} } @Proceedings{ coleman.li:large-scale, year = {1990}, editor = {T. F. Coleman and Y. Li}, publisher = {SIAM}, address = {Philadelphia, Pennsylvania}, note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell University, Ithaca, New York, October 19-20, 1989}, booktitle = {Large-Scale Numerical Optimization} } @Book{ davis:genetic, title = {Genetic Algorithms and Simulated Annealing}, year = {1987}, editor = {L. D. Davis}, publisher = {Pitman}, address = {London}, booktitle = {Genetic Algorithms and Simulated Annealing} } @Proceedings{ ferris.pang:complementarity, title = {Complementarity and Variational Problems: State of the Art}, booktitle = {Complementarity and Variational Problems: State of the Art}, year = {1997}, key = {57}, editor = {M. C. Ferris and J. S. Pang}, publisher = {SIAM Publications}, address = {Philadelphia, Pennsylvania} } @Proceedings{ ferris.mangasarian.ea:complementarity, title = {Complementarity: Applications, Algorithms and Extensions}, booktitle = {Complementarity: Applications, Algorithms and Extensions}, year = {2001}, key = {95}, editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, publisher = {Kluwer Academic Publishers}, address = {Dordrecht, The Netherlands} } @Proceedings{ florian:traffic, title = {Traffic Equilibrium Methods}, year = {1976}, editor = {M. Florian}, publisher = {Springer-Verlag}, address = {Berlin} } @Proceedings{ grefenstette:genetic, title = {Genetic Algorithms and their Applications: Proceedings of the Second International Conference on Genetic Algorithms}, year = {1987}, editor = {J. J. Grefenstette}, publisher = {Lawrence Erlbaum Associates}, address = {Hillsdale, New Jersey}, booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second International Conference on Genetic Algorithms} } @Proceedings{ mangasarian.meyer.ea:nonlinear*2, booktitle = {Nonlinear Programming}, volume = {2}, editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, publisher = {Academic Press}, address = {New York}, year = {1975} } @Proceedings{ mangasarian.meyer.ea:nonlinear*3, booktitle = {Nonlinear Programming}, volume = {3}, editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, publisher = {Academic Press}, address = {London}, year = {1978} } @Proceedings{ robinson:local, title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: Regularity}, year = {1983}, editor = {V. Pereyra and A. Reinoza}, publisher = {Springer-Verlag}, address = {Berlin}, author = {S. M. Robinson}, pages = {240--251}, series = {Numerical Methods: Proceedings, Caracas 1982} } @Proceedings{ schaeffer:third, year = {1989}, editor = {J. D. Schaeffer}, publisher = {Morgan Kaufmann Publishers, Inc}, address = {San Mateo, California}, booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} } @Book{ vanderbei:linear, author = {R. J. Vanderbei}, title = {Linear Programming: Foundations and Extensions}, year = {1997}, publisher = {Kluwer Academic Publishers}, address = {Boston, Massachusetts} } @Book{ dfobook, title = {Introduction to Derivative-Free Optimization}, publisher = {Society for Industrial and Applied Mathematics}, year = {2009}, author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, series = {MPS/SIAM Series on Optimization}, address = {Philadelphia, PA, USA}, isbn = {0-89871-460-5} } @Article{ unedf0, author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, title = {Nuclear Energy Density Optimization}, journal = {Physical Review C}, year = {2010}, volume = {82}, number = {2}, pages = {024313}, doi = {10.1103/PhysRevC.82.024313} } @Article{ hestenes1969multiplier, title = {Multiplier and gradient methods}, author = {Hestenes, Magnus R}, journal = {Journal of optimization theory and applications}, volume = {4}, number = {5}, pages = {303--320}, year = {1969}, publisher = {Springer} } @Article{ powell1969method, title = {A method for nonlinear constraints in minimization problems}, author = {Powell, Michael JD}, journal = {Optimization}, pages = {283--298}, year = {1969}, publisher = {Academic Press} } @Book{ nocedal2006numerical, title = {Numerical optimization}, author = {Jorge Nocedal and Stephen Wright}, year = {2006}, publisher = {Springer Science \& Business Media} } @Article{ rockafellar1974augmented, title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, author = {Rockafellar, R Tyrrell}, journal = {SIAM Journal on Control}, volume = {12}, number = {2}, pages = {268--285}, year = {1974}, publisher = {SIAM} } @Article{ bacuta2006, title = {A unified approach for Uzawa algorithms}, author = {Constantin Bacuta}, journal = {SIAM Journal on Numerical Analysis}, volume = {44}, number = {6}, pages = {2633--2649}, year = {2006} } @Article{ manteuffelrugesouthworth2018, title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction (AIR)}, author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, journal = {SIAM Journal on Scientific Computing}, volume = {40}, number = {6}, pages = {A4105--A4130}, year = {2018} } @Article{ manteuffelmunzenmaierrugesouthworth2019, title = {Nonsymmetric reduction-based algebraic multigrid}, author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, journal = {SIAM Journal on Scientific Computing}, volume = {41}, number = {5}, pages = {S242--S268}, year = {2019} } @PhDThesis{ sivas2021, title = {Preconditioning of HDG for the Navier–Stokes Equations}, author = {Abdullah Ali Sivas}, department = {Applied Mathematics}, institution = {University of Waterloo}, year = {2021} } @Article{ brookshughes1982, title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows with particular emphasis on the incompressible {Navier-Stokes} equations}, author = {Alexander N Brooks and Thomas JR Hughes}, journal = {Computer methods in applied mechanics and engineering}, volume = {32}, number = {1-3}, pages = {199--259}, year = {1982}, publisher = {Elsevier} } @InProceedings{ suhisaac2020, title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, author = {Hansol Suh and Tobin Isaac}, booktitle = {SC20: International Conference for High Performance Computing, Networking, Storage and Analysis}, pages = {1--12}, year = {2020}, organization = {IEEE} } @Misc{ alauzet2010, title = {Metric-Based Anisotropic Mesh Adaptation}, author = {Fr\'{e}d\'{e}ric Alauzet}, howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, year = {2010} } @Article{ chan1994qmrcgs, title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric systems}, author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd and Tong, Charles H}, journal = {SIAM Journal on Scientific Computing}, volume = {15}, number = {2}, pages = {338--347}, year = {1994}, publisher = {SIAM} } @Article{ ghai2019comparison, title = {A comparison of preconditioned {K}rylov subspace methods for large-scale nonsymmetric linear systems}, author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, journal = {Numerical Linear Algebra with Applications}, volume = {26}, number = {1}, pages = {e2215}, year = {2019}, publisher = {Wiley Online Library} } @Article{ mishrasalacknepley2025, title = {Stencil Composition for Finite Difference Approximations of Partial Differential Equations}, author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, journal = {SIAM Journal on Scientific Computing}, volume = {47}, number = {2}, doi = {10.1137/23M1596478}, year = {2025} } @Article{ nathawaniknepley2022, title = {Droplet formation simulation using mixed finite elements}, author = {Darsh K. Nathawani and Matthew G. Knepley}, journal = {Physics of Fluids}, volume = {34}, pages = {064105}, doi = {10.1063/5.0089752}, year = {2022} } @InProceedings{ nathawaniknepley2022b, title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, author = {Darsh K. Nathawani and Matthew G. Knepley}, booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 (ICCFD11)}, editor = {Christoph Brehm and Shishir Pandya}, number = {4103}, year = {2022} } @Article{ nathawaniknepley2023, title = {A one-dimensional mathematical model for shear-induced droplet formation in co-flowing fluids}, author = {Darsh K. Nathawani and Matthew G. Knepley}, journal = {Theoretical and Computational Fluid Dynamics}, url = {https://rdcu.be/dFtlR}, doi = {10.1007/s00162-024-00690-5}, year = {2024} } @InProceedings{ georgalisnathawaniknepleypatra2023, title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani Patra}, booktitle = {AIAA SciTech 2024}, note = {Accepted}, year = {2023} } @Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. Thompson and Junchao Zhang}, doi = {10.48550/ARXIV.2204.01722}, url = {https://arxiv.org/abs/2204.01722}, publisher = {arXiv}, note = {Submitted}, year = {2022} } @InCollection{ mayknepley2023, title = {Numerical Modeling of Subduction}, author = {Dave A. May and Matthew G. Knepley}, booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, editor = {João C. Duarte}, pages = {539-571}, isbn = {978-0-323-85733-8}, doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, year = {2023} } @Article{ adamswangmersonhucksknepley2024, title = {A performance portable, fully implicit {Landau} collision operator with batched linear solvers}, author = {Mark F. Adams and Peng Wang and Jacob Merson and Kevin Hucks and Matthew G. Knepley}, journal = {SIAM Journal on Scientific Computing}, volume = {47}, number = {2}, pages = {B360-B381}, doi = {10.1137/24M1640252}, url = {https://arxiv.org/abs/2209.03228}, year = {2025}, petsc_uses = {DMPlex} } @Article{ adamsknepley2023, title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized plasmas in {PETSc}}, author = {Mark F. Adams and Matthew G. Knepley}, url = {https://arxiv.org/abs/2302.10242}, note = {In preparation}, year = {2023}, petsc_uses = {DMPlex} } @Article{ finnknepleypusztayadams2023, title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, url = {https://arxiv.org/abs/2303.12620}, journal = {Communications in Applied Mathematics and Computational Science}, volume = {18}, number = {1}, pages = {135--152}, doi = {10.2140/camcos.2023.18.135}, year = {2023}, petsc_uses = {DMPlex} } @Article{ adamsfinnknepleypusztay2025, title = {A projection method for particle resampling}, author = {Mark F. Adams and Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay}, url = {https://arxiv.org/abs/2501.13681}, journal = {Computer Physics Communications}, note = {Submitted}, year = {2025}, petsc_uses = {DMPlex} } @Article{ finnpusztayknepleyadams2025, title = {Entropy Monotonicity using {Discrete Gradients} in the {Vlasov-Poisson-Landau} System}, author = {Daniel S. Finn and Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, journal = {Journal of Computational Physics}, note = {Submitted}, year = {2025} } @Article{ hamhaplaknepleymitchellsagiyama2024, title = {Efficient N-to-M Checkpointing Algorithm for Finite Element Simulations}, author = {David A. Ham and Vaclav Hapla and Matthew G. Knepley and Lawrence Mitchell and Koki Sagiyama}, journal = {SIAM Journal on Scientific Computing}, volume = {46}, number = {6}, url = {https://arXiv.org/abs/2401.05868}, doi = {10.1137/23M161372}, year = {2024}, petsc_uses = {DMPlex} } @InProceedings{ retfalviknepleydesjardin2025, title = {Performance Modeling and Scaling of PETSc based Direct Numerical Simulations for Hybrid Rocket Boundary Layers}, author = {Kolos Retfalvi and Matthew G. Knepley and Paul E. DesJardin}, booktitle = {Proceedings of the ASME 2025, Fluids Engineering Division Summer Meeting}, note = {Accepted}, year = {2025} } @Article{ retfalviwhitesidesmcgurnknepleydesjardin2025, title = {Direct Numerical Simulations for Hybrid Rocket Boundary Layers: Performance Modeling and Scaling}, author = {Kolos Retfalvi and Russell Whitesides and Matthew McGurn and Matthew G. Knepley and Paul E. DesJardin}, journal = {International Journal of High Performance Computing Applications}, note = {Submitted}, year = {2025} } @Article{ eggersdupont1994, title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} equation}, author = {Jens Eggers and Todd F. Dupont}, journal = {Journal of fluid mechanics}, volume = {262}, pages = {205--221}, year = {1994}, publisher = {Cambridge University Press} } @PhDThesis{ pusztaythesis2023, title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, author = {Joseph V. Pusztay}, type = {{PhD} thesis}, school = {University at Buffalo, Department of Computer Science and Engineering}, address = {Buffalo, NY}, month = may, year = {2022} } @PhDThesis{ finnthesis2023, title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau System}, author = {Daniel S. Finn}, type = {{PhD} thesis}, school = {University at Buffalo, Program in Computational and Data-Enabled Science and Engineering}, address = {Buffalo, NY}, month = may, year = {2023} } @PhDThesis{ nathawanithesis2023, title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, author = {Darsh Kiritbhai Nathawani}, type = {{PhD} thesis}, school = {University at Buffalo, Program in Computational and Data-Enabled Science and Engineering}, address = {Buffalo, NY}, month = may, year = {2023} } @PhDThesis{ dentonthesis2022, title = {Geometry Aware Mesh Topologies}, author = {Brandon Lee Denton}, type = {{PhD} thesis}, school = {University at Buffalo, Department of Mechanical and Aerospace Engineering}, address = {Buffalo, NY}, month = may, year = {2022} } @Book{ glassables2003, title = {UNIX for Programmers and Users}, author = {Graham Glass and King Ables}, year = {2003}, publisher = {Pearson Education India} } @Book{ neuenschwander2017, title = {{Emmy} {Noether's} wonderful theorem}, author = {Dwight E. Neuenschwander}, year = {2017}, publisher = {JHU Press} } @Article{ horvath2004, title = {On the positivity of matrix-vector products}, author = {Zoltan Horvath}, journal = {Linear algebra and its applications}, volume = {393}, pages = {253--258}, year = {2004} } @Article{ kraus2017, title = {Metriplectic integrators for the {Landau} collision operator}, author = {Michael Kraus and Eero Hirvijoki}, journal = {Physics of Plasmas}, volume = {24}, number = {10}, year = {2017} } @Article{ ottinger2018, title = {{GENERIC} Integrators: Structure Preserving Time Integration for Thermodynamic Systems}, author = {Hans Christian {\"O}ttinger}, journal = {Journal of Non-Equilibrium Thermodynamics}, volume = {43}, issue = {2}, pages = {89--100}, doi = {10.1515/jnet-2017-0034}, issn = {14374358}, month = {4}, year = {2018} } @Article{ sureshhuynh1997, title = {Accurate Monotonicity-Preserving Schemes with {Runge--Kutta} Time Stepping}, author = {A. Suresh and H.T. Huynh}, journal = {Journal of Computational Physics}, volume = {136}, number = {1}, pages = {83--99}, issn = {0021-9991}, doi = {10.1006/jcph.1997.5745}, year = {1997} } @Article{ ketcheson2019, title = {Relaxation {Runge--Kutta} methods: Conservation and stability for inner-product norms}, author = {David I Ketcheson}, journal = {SIAM Journal on Numerical Analysis}, volume = {57}, number = {6}, pages = {2850--2870}, year = {2019} } @Article{ ranochaketcheson2020, title = {Relaxation {Runge--Kutta} methods for {Hamiltonian} problems}, author = {Hendrik Ranocha and David I Ketcheson}, journal = {Journal of Scientific Computing}, volume = {84}, number = {1}, pages = {17}, year = {2020} } @Article{ munthekaas1999, title = {High order {Runge--Kutta} methods on manifolds}, author = {Hans Munthe-Kaas}, journal = {Applied Numerical Mathematics}, volume = {29}, number = {1}, pages = {115--127}, year = {1999} } @Article{ brower1971chiral, title = {A chiral invariant dual model}, author = {Richard C Brower}, journal = {Physics Letters B}, volume = {34}, number = {2}, pages = {143--146}, year = {1971} } @misc{ skeelcieslinski2020, title = {On the famous unpublished preprint ``{Methods} of integration which preserve the contact transformation property of the {Hamilton} equations'' by {Ren\'e De Vogelaere}}, author = {Robert D. Skeel and Jan L. Cie{\'s}li{\'n}ski}, eprint = {2003.12268}, archivePrefix = {arXiv}, primaryClass = {math.NA}, url = {https://arxiv.org/abs/2003.12268}, year = {2020} } @PhdThesis{ bonelle2014, title = {{Compatible Discrete Operator} schemes on polyhedral meshes for elliptic and {Stokes} equations}, author = {J{\'e}r{\^o}me Bonelle}, school = {Universit{\'e} Paris-Est}, year = {2014} } @Article{ jansenwhitinghulbert2000, title = {A generalized-$\alpha$ method for integrating the filtered Navier--Stokes equations with a stabilized finite element method}, author = {Kenneth E Jansen and Christian H Whiting and Gregory M Hulbert}, journal = {Computer methods in applied mechanics and engineering}, volume = {190}, number = {3-4}, pages = {305--319}, year = {2000} } @Article{ shampine1982, title = {Implementation of {Rosenbrock} methods}, author = {Lawrence F Shampine}, journal = {ACM Transactions on Mathematical Software (TOMS)}, volume = {8}, number = {2}, pages = {93--113}, year = {1982} } @Article{ benettingiorgilli1994, title = {On the {Hamiltonian} interpolation of near-to-the identity symplectic mappings with application to symplectic integration algorithms}, author = {Giancarlo Benettin and Antonio Giorgilli}, journal = {Journal of Statistical Physics}, volume = {74}, pages = {1117--1143}, year = {1994} } @Article{ qintang2013, title = {Why is {Boris} algorithm so good?}, author = {Hong Qin and Shuangxi Zhang and Jianyuan Xiao and Jian Liu and Yajuan Sun and William M Tang}, journal = {Physics of Plasmas}, volume = {20}, number = {8}, year = {2013} } @Article{ gonzalez1996, title = {Time integration and discrete {Hamiltonian} systems}, author = {Oscar Gonzalez}, journal = {Journal of Nonlinear Science}, volume = {6}, pages = {449--467}, year = {1996} } @Article{ hartenlaxvanleer1983, title = {On upstream differencing and Godunov-type schemes for hyperbolic conservation laws}, author = {Amiram Harten and Peter D Lax and Bram van Leer}, journal = {SIAM review}, volume = {25}, number = {1}, pages = {35--61}, year = {1983} } @article{MckayEriksonKozdon2019, title = {A computational method for earthquake cycles within anisotropic media}, author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, journal = {Geophysical Journal International}, volume = {219}, number = {2}, pages = {816--833}, year = {2019}, } @article{EricksonOReillyNordstrom2019, title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, journal = {Journal of Scientific Computing}, volume = {81}, pages = {2356--2387}, year = {2019}, } @article{KozdonEricksonWilcox2021, title = {Hybridized summation-by-parts finite difference methods}, author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, journal = {Journal of Scientific Computing}, volume = {87}, number = {3}, pages = {85}, year = {2021}, } @article{SEAS2022, title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {127}, number = {3}, pages = {e2021JB023519}, year = {2022}, } @article{EricksonKozdonHarvey2022, title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, journal = {Journal of Scientific Computing}, volume = {93}, number = {1}, pages = {17}, year = {2022}, } @article{RuckerEriksonKarlstromLeeGopalakrishnan2022, title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, journal = {Journal of Geophysical Research: Solid Earth}, volume = {127}, number = {9}, pages = {e2022JB024506}, year = {2022}, } @article{HarveyEriksonKozdon2023, title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, journal = {Journal of Geophysical Research: Solid Earth}, pages = {e2022JB025357}, year = {2023}, } @article{SEAS2023, title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, journal = {Bulletin of the Seismological Society of America}, volume = {113}, number = {2}, pages = {499--523}, year = {2023}, } @article{ErwayMarcia2017, title = {On solving large-scale limited-memory quasi-{N}ewton equations}, author = {Erway, Jennifer B and Marcia, Roummel F}, journal = {Linear Algebra and its Applications}, volume = {515}, pages = {196--225}, year = {2017}, publisher = {Elsevier}, } @article{Ritto-CorreaCamotim2008, title={On the arc-length and other quadratic control methods: Established, less known and new implementation procedures}, volume={86}, ISSN={0045-7949}, DOI={10.1016/j.compstruc.2007.08.003}, number={11}, journal={Computers & Structures}, author={Ritto-Corr{\^{e}}a, Manuel and Camotim, Dinar}, year={2008}, month=jun, pages={1353-1368}, } @article{LeonPaulinoPereiraMenezesLages_2011, title={A Unified Library of Nonlinear Solution Schemes}, volume={64}, ISSN={0003-6900, 2379-0407}, DOI={10.1115/1.4006992}, number={4}, journal={Applied Mechanics Reviews}, author={Leon, Sofie E. and Paulino, Glaucio H. and Pereira, Anderson and Menezes, Ivan F. M. and Lages, Eduardo N.}, year={2011}, month=jul, pages={040803}, }